Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000034000
  • symbol?: walH
  • description?: YycH protein

      descriptions from strain specific annotations:

    • YycH protein
    • yycH family protein
    • two-component regulator YycH
  • strand?: +
  • coordinates?: 33869..35230
  • synteny block?: BlockID0000310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0021 (yycH)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0020 (yycH)
    08BA02176:
    C248_0023 (yycH)
    11819-97:
    MS7_0022
    71193:
    ST398NM01_0022
    ECT-R 2:
    ECTR2_22
    ED133:
    SAOV_0022 (yycH)
    ED98:
    SAAV_0024 (yycH)
    HO 5096 0412:
    SAEMRSA15_00200 (yycH)
    JH1:
    SaurJH1_0020
    JH9:
    SaurJH9_0020
    JKD6008:
    SAA6008_00020 (yycH)
    JKD6159:
    SAA6159_00020 (yycH)
    LGA251:
    SARLGA251_00200 (yycH)
    M013:
    M013TW_0023
    MRSA252:
    SAR0020 (yycH)
    MSHR1132:
    SAMSHR1132_00210
    MSSA476:
    SAS0020
    Mu3:
    SAHV_0020
    Mu50:
    SAV0020
    MW2:
    MW0020
    RF122:
    SAB0020 (yycH)
    ST398:
    SAPIG0022
    T0131:
    SAT0131_00022 (gpsA)
    TCH60:
    HMPREF0772_10448 (yycH)
    TW20:
    SATW20_00200 (yycH)
    USA300_TCH1516:
    USA300HOU_0020 (yycH)
    VC40:
    SAVC_00100

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTT
    N315            MKSLKTVIGMNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTT
    NCTC8325        --------------------------MSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTT
    Newman          MKSLKTVIGMNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTT
    USA300_FPR3757  --------------------------MSVVLTYMVWNFSPDIANVDNTDSKKSETKPLTT
                                              **********************************

    COL             PMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIP
    N315            PMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIP
    NCTC8325        PMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIP
    Newman          PMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIP
    USA300_FPR3757  PMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRRDHNLMIP
                    ************************************************************

    COL             DLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRH
    N315            DLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRH
    NCTC8325        DLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRH
    Newman          DLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRH
    USA300_FPR3757  DLNSDFILFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDHDADDNIVLYAISKDRH
                    **.*** *****************************************************

    COL             DYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVF
    N315            DYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVF
    NCTC8325        DYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVF
    Newman          DYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVF
    USA300_FPR3757  DYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPEKLKTYRMVF
                    ************************************************************

    COL             NTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKM
    N315            NTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKM
    NCTC8325        NTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKM
    Newman          NTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKM
    USA300_FPR3757  NTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNLSEDEASSSKM
                    ************************************************************

    COL             EETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGE
    N315            EETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGE
    NCTC8325        EETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGE
    Newman          EETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGE
    USA300_FPR3757  EETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKEGSNQIQVTWGE
                    ************************************************************

    COL             KGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSD
    N315            KGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSD
    NCTC8325        KGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSD
    Newman          KGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSD
    USA300_FPR3757  KGVFDYRRSLLRTDVVLNSEDNKSLPKLESVRSSLANNSDINFEKVTNIAIGYEMQDNSD
                    ***********************:************************************

    COL             HNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
    N315            HNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
    NCTC8325        HNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
    Newman          HNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
    USA300_FPR3757  HNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE
                    *********************************