From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000102000
  • symbol?: mecR1
  • description?: beta-lactam sensor/signal transducer MecR1

      descriptions from strain specific annotations:

    • beta-lactam sensor/signal transducer MecR1
    • methicillin-resistance MecR1 regulatory protein
    • methicillin resistance protein
    • methicillin resistance regulatory protein MecR1
    • Beta-lactamase
    • Methicillin resistance mecR1 protein
    • methicillin resistance protein MecR (fragment)
    • Methicillin resistance regulatory sensor-transducer MecR1
    • peptidase M48 family protein
    • pseudogene
    • truncated methicillin resistance protein MecR1
  • strand?: +
  • coordinates?: 120800..122796
  • synteny block?: BlockID0000800
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0034 (mecR1)
    N315:
    SA0039 (mecR1)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0040 (mecR1)
    08BA02176:
    11819-97:
    MS7_0034
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00320 (mecR)
    JH1:
    SaurJH1_0030
    JH9:
    SaurJH9_0030
    JKD6008:
    SAA6008_00040 (mecR1)
    JKD6159:
    SAA6159_00032 (mecR1)
    LGA251:
    M013:
    MRSA252:
    SAR0040 (mecR1)
    MSHR1132:
    SAMSHR1132_00330
    MSSA476:
    Mu3:
    SAHV_0041 (mecR1)
    Mu50:
    SAV0042 (mecR1)
    MW2:
    MW0032
    RF122:
    ST398:
    T0131:
    SAT0131_00035
    TCH60:
    HMPREF0772_10434 (mecR)
    TW20:
    SATW20_00750 (mecR1)
    USA300_TCH1516:
    USA300HOU_0032 (mecR1)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNF
    N315            MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNF
    USA300_FPR3757  MLSSFLMLSIISSLLTICVIFLVRMLYIKYTQNIMSHKIWLLVLVSTLIPLIPFYKISNF
                    ************************************************************

    COL             TFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLC
    N315            TFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLC
    USA300_FPR3757  TFSKDMMNRNVSDTTSSVSHMLDGQQSSVTKDLAINVNQFETSNITYMILLIWVFGSLLC
                    ************************************************************

    COL             LFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVK
    N315            LFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVK
    USA300_FPR3757  LFYMIKAFRQIDVIKSSSLESSYLNERLKVCQSKMQFYKKHITISYSSNIDNPMVFGLVK
                    ************************************************************

    COL             SQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMM
    N315            SQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMM
    USA300_FPR3757  SQIVLPTVVVETMNDKEIEYIILHELSHVKSHDLIFNQLYVVFKMIFWFNPALYISKTMM
                    ************************************************************

    COL             DNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKY
    N315            DNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKY
    USA300_FPR3757  DNDCEKVCDRNVLKILNRHEHIRYGESILKCSILKSQHINNVAAQYLLGFNSNIKERVKY
                    ************************************************************

    COL             IALYDSMPKPNRNKRIVAYIVCSIS-----------------------------------
    N315            IALYDSMPKPNRNKRIVAYIVCSISLLIQAPLLSAHVQQDKYETNVSYKKLNQLAPYFKG
    USA300_FPR3757  IALYDSMPKPNRNKRIVAYIVCSIS-----------------------------------
                    *************************                                   

    COL             ---SFT------------------------------------------------------
    N315            FDGSFVLYNEREQAYSIYNEPESKQRYSPNSTYKIYLALMAFDQNLLSLNHTEQQWDKHQ
    USA300_FPR3757  ---SFT------------------------------------------------------
                       **.                                                      

    COL             ------------------------------------------------------------
    N315            YPFKEWNQDQNLNSSMKYSVNWYYENLNKHLRQDEVKSYLDLIEYGNEEISGNENYWNES
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             ------------------------------------------------------------
    N315            SLKISAIEQVNLLKNMKQHNMHFDNKAIEKVENSMTLKQKDTYKYVGKTGTGIVNHKEAN
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             ---------------------------------------------
    N315            GWFVGYVETKDNTYYFATHLKGEDNANGEKAQQISERILKEMELI
    USA300_FPR3757  ---------------------------------------------