From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000382000
  • symbol?:
  • description?: tRNA-dihydrouridine synthase

      descriptions from strain specific annotations:

    • tRNA-dihydrouridine synthase
    • dihydrouridine synthase (Dus) family protein
    • nitrogen regulation protein NIFR3
    • putative tRNA-dihydrouridine synthase
    • tRNA dihydrouridine synthase B
  • strand?: -
  • coordinates?: 391879..392865
  • synteny block?: BlockID0001730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0089
    08BA02176:
    C248_0078
    11819-97:
    MS7_0083 (dus)
    71193:
    ST398NM01_0103
    ECT-R 2:
    ECTR2_47
    ED133:
    SAOV_0041
    ED98:
    SAAV_0037
    HO 5096 0412:
    SAEMRSA15_00530
    JH1:
    SaurJH1_0079
    JH9:
    SaurJH9_0077
    JKD6008:
    SAA6008_00075 (dus)
    JKD6159:
    SAA6159_00068 (dus)
    LGA251:
    SARLGA251_00690
    M013:
    M013TW_0076
    MRSA252:
    SAR0099
    MSHR1132:
    SAMSHR1132_00650
    MSSA476:
    SAS0059
    Mu3:
    SAHV_0088
    Mu50:
    SAV0089
    MW2:
    MW0059
    RF122:
    SAB0033c
    ST398:
    SAPIG0103
    T0131:
    SAT0131_00075
    TCH60:
    HMPREF0772_10401
    TW20:
    SATW20_01080
    USA300_TCH1516:
    USA300HOU_0096
    VC40:
    SAVC_00170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------MEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVR
    N315            MKENFWSELPRPFFILAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVR
    NCTC8325        ------------------MEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVR
    Newman          MKENFWSELPRPFFILAPMEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVR
    USA300_FPR3757  ------------------MEDVTDIVFRHVVSEAARPDVFFTEFTNTESFCHPEGIHSVR
                                      ******************************************

    COL             GRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLI
    N315            GRLTFSEDEHPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLI
    NCTC8325        GRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLI
    Newman          GRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLI
    USA300_FPR3757  GRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMGCPVANVAKKGKGSGLI
                    *********:**************************************************

    COL             LRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMS
    N315            LRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMS
    NCTC8325        LRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMS
    Newman          LRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMS
    USA300_FPR3757  LRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFEQDIANLSIHLRTRKEMS
                    ************************************************************

    COL             KVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
    N315            KVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
    NCTC8325        KVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
    Newman          KVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
    USA300_FPR3757  KVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAEKYGIDGVMIGRGIFHNPF
                    ************************************************************

    COL             AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQL
    N315            AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQL
    NCTC8325        AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQL
    Newman          AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQL
    USA300_FPR3757  AFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRGASELRHQL
                    ************************************************************

    COL             MNTQSIAEARALLDEFEAQMDEDVKIEL
    N315            MNTQSIAEARALLDEFEAQMDEDVKIEL
    NCTC8325        MNTQSIAEARALLDEFEAQMDEDVKIEL
    Newman          MNTQSIAEARALLDEFEAQMDEDVKIEL
    USA300_FPR3757  MNTQSIAEARALLDEFEAQMDEDVKIEL
                    ****************************