From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000385000
  • symbol?:
  • description?: Major Facilitator Superfamily protein

      descriptions from strain specific annotations:

    • Major Facilitator Superfamily protein
    • H+ antiporter protein
    • transport protein
    • Macrolide-efflux protein
    • permease
    • putative permease
    • major facilitator transporter
  • strand?: -
  • coordinates?: 393696..394757
  • synteny block?: BlockID0001760
  • occurrence?: in 47% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_0081
    11819-97:
    71193:
    ST398NM01_0105
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00560
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00071
    LGA251:
    SARLGA251_00710
    M013:
    M013TW_0078
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0062
    Mu3:
    Mu50:
    MW2:
    MW0062
    RF122:
    ST398:
    SAPIG0105
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0099
    VC40:
    SAVC_00185

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLAS
    NCTC8325        MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLAS
    Newman          MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLAS
    USA300_FPR3757  MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLLGIMLALNVLSGFLAS
                    ************************************************************

    COL             PIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMA
    NCTC8325        PIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMA
    Newman          PIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMA
    USA300_FPR3757  PIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLVIGFAIVNGIGWTTYMA
                    ************************************************************

    COL             TSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLIS
    NCTC8325        TSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLIS
    Newman          TSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLIS
    USA300_FPR3757  TSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKINGFTLIIAMTIMMFLIS
                    ************************************************************

    COL             IFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNIS
    NCTC8325        IFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNIS
    Newman          IFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNIS
    USA300_FPR3757  IFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFIFGVISIIPMVFTMIFNIS
                    ************************************************************

    COL             LPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSAL
    NCTC8325        LPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSAL
    Newman          LPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSAL
    USA300_FPR3757  LPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKISTKVLIFLLYFILVINSAL
                    ************************************************************

    COL             FIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIA
    NCTC8325        FIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIA
    Newman          FIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIA
    USA300_FPR3757  FIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKYVGRSFTIWTSISLLLQSLIA
                    ************************************************************

    COL             PFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKIKYAHKEE
    NCTC8325        PFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKIKYAHKEE
    Newman          PFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKIKYAHKEE
    USA300_FPR3757  PFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTGKIKYAHKEE
                    ************************************.*********