From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000444000
  • symbol?: ccrB
  • description?: cassette chromosome recombinase B

      descriptions from strain specific annotations:

    • cassette chromosome recombinase B
    • recombinase RecB
    • Cassette chromosome recombinase B3
    • pseudogene
    • resolvase
    • resolvase, N terminal domain protein
    • resolvase domain-containing protein
    • site-specific recombinase
    • site-specific recombinase CcrB3
  • strand?: -
  • coordinates?: 451459..453087
  • synteny block?: BlockID0001930
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0041 (ccrB)
    N315:
    SA0057 (ccrB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0061 (ccrB)
    08BA02176:
    11819-97:
    MS7_0069
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00360 (ccrB)
    JH1:
    SaurJH1_0049
    JH9:
    SaurJH9_0048
    JKD6008:
    SAA6008_00057 (ccrB)
    JKD6159:
    SAA6159_00038 (ccrB)
    LGA251:
    SARLGA251_00360 (ccrB3)
    M013:
    MRSA252:
    SAR0059 (ccrB)
    MSHR1132:
    SAMSHR1132_00400
    MSSA476:
    SAS0032 (ccrB)
    Mu3:
    SAHV_0060 (ccrB)
    Mu50:
    SAV0061 (ccrB)
    MW2:
    MW0038 (ccrB)
    RF122:
    ST398:
    T0131:
    SAT0131_00055 (dnaC)
    TCH60:
    HMPREF0772_10428 (ccrB)
    TW20:
    SATW20_00910 (ccrB)
    USA300_TCH1516:
    USA300HOU_0039 (ccrB)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MQQLKTKRVGIYVRVSTEMQSTEGYSIDGQINQIKEYCDFHHFEVKDIYADRGISGKSMN
    USA300_FPR3757  MQQLKTKRVGIYVRVSTEMQSTEGYSIDGQINQIKEYCDFHHFEVKDIYADRGISGKSMN
                    ************************************************************

    N315            RPELQRILKDAKEGYIDCVMVYKTNRLARNTSDLLKIVEDLHKQNVEFFSLSERMEVNTS
    USA300_FPR3757  RPELQRMLKDAKEGNIDCVMVYKTNRLARNTSDLLKIVEDLHKQNVEFFSLSERMEVNTS
                    ******:******* *********************************************

    N315            SGKLMLQILASFSEFERNNIVENVFMGQTRRAQEGYYQGNLPLGYDKIPNSKHELMINQH
    USA300_FPR3757  SGKLMLQILASFSEFERNNIVENVFMGQTRRAQEGYYQGNLPLGYDKIPDSKHELMINQH
                    *************************************************:**********

    N315            EANIVKYIFESYAKGHGYRKIANALNHKGYVTKKGKPFSISSITYILANPFYIGKIQFAK
    USA300_FPR3757  EANIVKYIFECYAKGHGYRKIANALNHKGYVTKKGKPFSISSITYILANPFYIGKIQFAK
                    **********.*************************************************

    N315            YKDWSEKRRKGLNDKPVIAEGKHSPIINQDLWDKVQMRKKQVSQKPQVHGKGTNLLTGII
    USA300_FPR3757  YKDWSEKRRKGLNDKPVIAEGKHSPIINQDLWDKVQMRKKQVSQKPQVHGKGTNLLTGII
                    ************************************************************

    N315            HCPQCGAPMAASNTTNTLKDGTKKRIRYYSCSNFRNKGSKVCSANSVRADVIEDYVMKQI
    USA300_FPR3757  HCPQCGAPMAASNTTNTLKDGTKKRIRYYSCSNFRNKGSKVCSANSVRADVIEDYVMKQI
                    ************************************************************

    N315            LEIVKSDKVIQRVVTHVNQENQVDGAALHHDIAYKQQQYDEVQIKLNNLIKTIEDNPDLT
    USA300_FPR3757  LEIVKSDKVIQRVVTHVNQENQVDGAALHHDIAYKQQQYDEVQIKINNLIKTIEDNPDLT
                    *********************************************:**************

    N315            SVIRPSIQKYEKQLNDITNQINQLKNQQNEDKPLFDAKEISKLLQHIFHDIKHIEKSRLK
    USA300_FPR3757  SVIRPSIQKYEKQLNDITNQINQLKNQQNEDKTLFDAKEISKLLQHIFHDIKHIEKSRLK
                    ********************************.***************************

    N315            ALYLSVIDRIDIKKDGNHKKQFYVTLKLNNEIIKQLFNNKQLDEVHLSTSSLFLPQTLYL
    USA300_FPR3757  ALYLSVIDRIDIKKDGNHKKQFYVTLKLNNEIIKQLFNNKQLDEVHLSTSSLFLPQTLYL
                    ************************************************************

    N315            TI
    USA300_FPR3757  TI
                    **