From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000445000
  • symbol?: ccrA
  • description?: cassette chromosome recombinase A

      descriptions from strain specific annotations:

    • cassette chromosome recombinase A
    • resolvase
    • resolvase domain-containing protein
    • resolvase, N terminal domain protein
    • cassette chromosome recombinase A1
    • site-specific recombinase
    • site-specific recombinase CcrA1
    • Cassette chromosome recombinase A3
  • strand?: -
  • coordinates?: 453109..454458
  • synteny block?: BlockID0001940
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0042 (ccrA1)
    N315:
    SA0058 (ccrA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0062 (ccrA)
    08BA02176:
    11819-97:
    MS7_0070
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_00370 (ccrA)
    JH1:
    SaurJH1_0050
    JH9:
    SaurJH9_0049
    JKD6008:
    SAA6008_00058 (ccrA)
    JKD6159:
    SAA6159_00039 (ccrA)
    LGA251:
    SARLGA251_00370 (ccrA1)
    M013:
    MRSA252:
    SAR0060 (ccrA)
    MSHR1132:
    SAMSHR1132_00410
    MSSA476:
    SAS0033 (ccrA1)
    Mu3:
    SAHV_0061 (ccrA)
    Mu50:
    SAV0062 (ccrA)
    MW2:
    MW0039 (ccrA)
    RF122:
    ST398:
    T0131:
    SAT0131_00056
    TCH60:
    HMPREF0772_10427 (ccrA)
    TW20:
    SATW20_00920 (ccrA)
    USA300_TCH1516:
    USA300HOU_0040 (ccrA)
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQAIGYLRQSTTKQQSLAAQKQTIEALAKKHNIQYITFYSDKQSGRTDKRNGYQQITEL
    N315            MKQVIGYLRQSTMKQQSLAAQKQAIEAIAEKHHIQHINFYSDKQSGRKDNRSGYRQMTQL
    USA300_FPR3757  MKQVIGYLRQSTMKQQSLAAQKQAIEAIAEKHHIQHINFYSDKQSGRKDNRSGYRQITQL
                    ***.******** **********:***:*:**:**:*.*********.*:*.**:*:*:*

    COL             IQQGQCDVLCCYRLNRLHRNLKNALKLMKLCQKYHVHILSVHDGYFDMDKAFDRLKLNIF
    N315            IQQGQCDILCCYRLNRLHRNLKNALKLIKLCQTYHVHILSVHDGYFDMDQAFDRFKLNIF
    USA300_FPR3757  IQQGQCDILCCYRLNRLHRNLKNALKLIKLCQTYHVHILSVHDGYFDMDQAFDRLKLNIF
                    *******:*******************:****.****************:****:*****

    COL             ISLAELESDNIGEQVKNGIKEKAKQGKMITTHAPFGYHYHNGTFTIDTVKAPTVKAVFNY
    N315            ISLAELESDNIGEQVRNGLQEKAKQGRLITTHAPFGYEYHNGAFIINQNESPTVKAVFNY
    USA300_FPR3757  ISLAELESDNIGEQVRNGLQEKAKQGRLITTHAPFGYEYHNGTFIINQNESPTVKAVFNY
                    ***************:**::******::*********.****:* *:  ::*********

    COL             YLQGYGYKKIAQYLEADDKFINRKPYQVRNIILNPNYCGRVINQYGQYENMFPAIVSTTI
    N315            YIKGHGYKKIAQLLEEDNTYINRQPYQVRNIIINPNYCGRVNNQYGQFDNMFPSIVSTSI
    USA300_FPR3757  YIKGHGYKKIAQLLEEDNTYINRQPYQVRNIIINPNYCGRVNNQYGQFDNMFPSIVSTSI
                    *::*:******* ** *:.:***:********:******** *****::****:****:*

    COL             YEEAQVTRTQKPVKRKPSENQLKQKIKCPYCDSTLTNMTIRKKHHTLRYYVCPQNMNASR
    N315            YEQAQRLRSQKQIKQTSSDNQLKQKIKCPCCNTTLTNMTVRKKNHTLRYYVCPKNMNASR
    USA300_FPR3757  YEQAQRLRLQKQTKQTPSDNQLKQKIKCPCCNATLTNMTIRKKNHTLRYYVCPKNMNASR
                    **:**  * **  *:..*:********** *::******:***:*********:******

    COL             FVCEFKGINAQELETSVLATCQDFFQNQQLYSKINHTIQQRLKRQRDIETKTTLNHEQLI
    N315            FVCDFKGINAQTLEDKVLEVCKDFYQNQRIYTKIKGAIDKRIKRQRNIEKHHTLTQEQLI
    USA300_FPR3757  FVCDFKGINAQTLEDKVLEVCRDFYQNQRIYTKIKSAIDKRIKRQRNIEKHHTLTQEQLI
                    ***:******* ** .** .*:**:***::*:**: :*::*:****:**.: **.:****

    COL             EKLAQDKIDAETFREQTQSLRQQSKPISSISTYQIRKAFQNIIQQRFTLNMLYPYIDEIN
    N315            EKLAQGIIDAETFREQTQSLRQQPQRTTSINGHQIQHTIQNIIQKRFTLNILYPYIETIH
    USA300_FPR3757  EKLAQGIIDAETFREQTQSLRQQPQRTTSINGHQIQHIIQNIIQKRFTLNILYPYIETIH
                    *****. ****************.:  :**. :**:: :*****:*****:*****: *:

    COL             ISKNKSLAGIYFKNEPLNIVKQTMELSIV
    N315            ITKDKNLIGIYFKNEPLNIVNQTMQSSIA
    USA300_FPR3757  ITKDKNLIGIYFKNEPLNIVNQTMQSSIA
                    *:*:*.* ************:***: **.