From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000509000
  • symbol?:
  • description?: metallo-beta-lactamase

      descriptions from strain specific annotations:

    • metallo-beta-lactamase
    • Zn-dependent hydrolase
    • metallo-beta-lactamase family protein
    • MBL fold metallo-hydrolase
    • metallo-beta-lactamase superfamily protein
  • strand?: -
  • coordinates?: 588119..589123
  • synteny block?: BlockID0002370
  • occurrence?: in 22% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    SAA6159_00045
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_00460
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    MW0045
    RF122:
    ST398:
    SAPIG0061
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0045
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHAD
    USA300_FPR3757  --------------------------MIIDPICDLSSYIRVADEESLTITHAAETHIHAN
                                              ****** ************.*************:

    COL             FASGIRDVAIKLNANIYVSGESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHT
    USA300_FPR3757  FVSGIRDVAIKLNASIYVSGESDDMLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHT
                    *.************.********* ***********************************

    COL             PESISFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEKAVKVEGSSEIGAKQMFKSIE
    USA300_FPR3757  PESISFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEKAVKVEGLSEIGAKQMFKSIE
                    ********************************************** *************

    COL             SIKDLPDYIQIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQP
    USA300_FPR3757  SIKDLPDYIQIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQP
                    ************************************************************

    COL             APPHHFAQMKKINQFGMNLYQPYTVYPATNTNRLTFDLRSKEAYHGGHIEGTINIPYDKN
    USA300_FPR3757  APPHHFAQMKKINQFGMNLYQPYTVYPATSTNRLTFDLRSKEAYHGGHIEGTINIPYDKN
                    *****************************.******************************

    COL             FINQIGWYLNYDQEINLIGDYHLVSKATHT-----LQLIGYDDIAGYQLPQSKIQTRSIH
    USA300_FPR3757  FINQIGWYLNYNQEINLIGDYHLVSKATHNILYNLLDMIMCLDISYHKL-----------
                    ***********:*****************.     *::*   **: ::*           

    COL             SEDITGNESHILDVRNDNEWNNGHLSQAVHVPHGKLLETDLPFNKNDVIYVHCQSGIRSS
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             IAIGILEHKGYHNIINVNEGYKDIQLS
    USA300_FPR3757  --------KFKHNLFIVK--------T
                            *  **:: *:        :