From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000859000
  • symbol?:
  • description?: pseudogene

      descriptions from strain specific annotations:

    • pseudogene
    • lipoprotein
    • staphylococcal tandem lipoprotein
    • putative lipoprotein
    • Tandem lipoprotein
    • putative lipoprotein, truncated
    • staphylococcus tandem lipoproteins family protein
  • strand?: +
  • coordinates?: 1128174..1128945
  • synteny block?: BlockID0004200
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0097
    08BA02176:
    11819-97:
    MS7_0091
    71193:
    ECT-R 2:
    ECTR2_54
    ED133:
    SAOV_0050
    ED98:
    SAAV_0045
    HO 5096 0412:
    SAEMRSA15_00680
    JH1:
    SaurJH1_0088
    JH9:
    SaurJH9_0085
    JKD6008:
    SAA6008_00081
    JKD6159:
    SAA6159_00080
    LGA251:
    SARLGA251_00760
    M013:
    MRSA252:
    SAR0106
    MSHR1132:
    MSSA476:
    SAS0073
    Mu3:
    SAHV_0096
    Mu50:
    SAV0097
    MW2:
    MW0072
    RF122:
    SAB0039
    ST398:
    T0131:
    SAT0131_00083
    TCH60:
    HMPREF0772_10394
    TW20:
    SATW20_01150
    USA300_TCH1516:
    USA300HOU_0110
    VC40:
    SAVC_00235

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    N315            MIKRVNKLVLGISFLFLIISIFAGCGTGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    NCTC8325        MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    Newman          MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRD
    USA300_FPR3757  MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYPIKNLEDLYDKEGYRD
                    *************:***:*** **** *********************************

    COL             DQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQ
    N315            DQFDKNDKGTWIVRSSMSIQSNGKDMNIKGMVLYMNRNTRTTNGYYYVDVIEREDKGIHR
    NCTC8325        DQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQ
    Newman          DQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQ
    USA300_FPR3757  DQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKGFYYTNEIKTEKYEVAQ
                    *************.*.*:**.:*: ::****:* ::****:::*:**.: *: *.  : :

    COL             DNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVP
    N315            DNEKRYPVKMVDNKIIPTKEIKDEKIKKEIENFKFFVQYGDFKDLSKYKDGDISYNPEVP
    NCTC8325        DNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVP
    Newman          DNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVP
    USA300_FPR3757  DNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFKDLMNYKDGDISYNPEVP
                    **:*:*****::**:*.*:*:*:*:***********.**.:**** :*************

    COL             SYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNE
    N315            SYSAKYQLTNDDYNVKQLRKRYNIPTNKAPKLLLKGTGNLKGSSIGYKKIEFTFVEKKGE
    NCTC8325        SYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNE
    Newman          SYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNE
    USA300_FPR3757  SYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKKIEFTFLENKNE
                    ****:*****************:*********************:*********:*:*.*

    COL             NIYFTDSLHLEPSEDK
    N315            NIYFSDGLHFNPSEDK
    NCTC8325        NIYFTDSLHLEPSEDK
    Newman          NIYFTDSLHLEPSEDK
    USA300_FPR3757  NIYFTDSLHLEPSEDK
                    ****:*.**::*****