From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000899000
  • symbol?:
  • description?: transporter

      descriptions from strain specific annotations:

    • transporter
    • Na/Pi-cotransporter II-like protein
    • Na/Pi cotransporter II-related protein
    • na+/Pi-cotransporter family protein
    • Na/Pi cotransporter family protein
    • PnaS family phosphate:sodium (Na+) symporter
    • Na+/Pi-cotransporter protein
    • putative Na+/Pi-cotransporter protein
    • Na+/phosphate symporter
    • membrane transporter
    • Sodium-dependent phosphate transporter
  • strand?: -
  • coordinates?: 1164692..1166353
  • synteny block?: BlockID0004370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0104
    08BA02176:
    C248_0094
    11819-97:
    MS7_0099
    71193:
    ST398NM01_0118
    ECT-R 2:
    ECTR2_61
    ED133:
    SAOV_0054
    ED98:
    SAAV_0072
    HO 5096 0412:
    SAEMRSA15_00730
    JH1:
    SaurJH1_0096
    JH9:
    SaurJH9_0092
    JKD6008:
    SAA6008_00085 (nptA)
    JKD6159:
    SAA6159_00090 (nptA)
    LGA251:
    SARLGA251_00800
    M013:
    M013TW_0094
    MRSA252:
    SAR0110
    MSHR1132:
    SAMSHR1132_00800
    MSSA476:
    SAS0081
    Mu3:
    SAHV_0103
    Mu50:
    SAV0104
    MW2:
    MW0080
    RF122:
    SAB0044c
    ST398:
    SAPIG0118
    T0131:
    SAT0131_00088
    TCH60:
    HMPREF0772_10390
    TW20:
    SATW20_01190
    USA300_TCH1516:
    USA300HOU_0116
    VC40:
    SAVC_00265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTSNPVLGVIAGIVVT
    N315            MEMSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTSNPVLGVIAGIVVT
    NCTC8325        --MSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTSNPVLGVIAGIVVT
    Newman          MEMSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTSNPVLGVIAGIVVT
    USA300_FPR3757  --MSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKFTSNPVLGVIAGIVVT
                      **********************************************************

    COL             ILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIGIDLGEYAMPILALG
    N315            ILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIGIDLGEYAMPILALG
    NCTC8325        ILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIGIDLGEYAMPILALG
    Newman          ILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIGIDLGEYAMPILALG
    USA300_FPR3757  ILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFIIGIDLGEYAMPILALG
                    ************************************************************

    COL             AFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGFKQLMLDMSTNPILAV
    N315            AFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGFKQLMLDMSSNPILAV
    NCTC8325        AFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGFKQLMLDMSTNPILAV
    Newman          AFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGFKQLMLDMSTNPILAV
    USA300_FPR3757  AFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLDGFKQLMLDMSTNPILAV
                    *****************************************************:******

    COL             IVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIGTTITAILASLAGSIAA
    N315            IVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIGTTITAILASLAGSIAA
    NCTC8325        IVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIGTTITAILASLAGSIAA
    Newman          IVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIGTTITAILASLAGSIAA
    USA300_FPR3757  IVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDNIGTTITAILASLAGSIAA
                    ************************************************************

    COL             KRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDLWHLKPAMTIAVSHGIFNITNTLIQL
    N315            KRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDVWHLKPAMTIAVSHGIFNITNTLIQL
    NCTC8325        KRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDLWHLKPAMTIAVSHGIFNITNTLIQL
    Newman          KRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDLWHLKPAMTIAVSHGIFNITNTLIQL
    USA300_FPR3757  KRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDLWHLKPAMTIAVSHGIFNITNTLIQL
                    **********************************:*************************

    COL             PFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQETQKELQNVGQIVLSMFE
    N315            PFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQETQKELQNVGQIVLSMFE
    NCTC8325        PFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQETQKELQNVGQIVLSMFE
    Newman          PFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQETQKELQNVGQIVLSMFE
    USA300_FPR3757  PFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVALQETQKELQNVGQIVLSMFE
                    ************************************************************

    COL             DIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKAITKADVERLAVMFDVNRSI
    N315            DIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKAITKADVERLAVMFDVNRSI
    NCTC8325        DIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKAITKADVERLAVMFDVNRSI
    Newman          DIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKAITKADVERLAVMFDVNRSI
    USA300_FPR3757  DIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRISTKAITKADVERLAVMFDVNRSI
                    ************************************************************

    COL             LKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVAESFDKAIDMLDVYDKTKKDE
    N315            LKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVAESFDKAIDMLDVYDKTKKDE
    NCTC8325        LKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVAESFDKAIDMLDVYDKTKKDE
    Newman          LKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVAESFDKAIDMLDVYDKTKKDE
    USA300_FPR3757  LKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNHVAESFDKAIDMLDVYDKTKKDE
                    ************************************************************

    COL             IVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDMIGVLERIGYHSRNVSEALVGL
    N315            IVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDMIGVLERIGYHSRNVSEALVGL
    NCTC8325        IVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDMIGVLERIGYHSRNVSEALVGL
    Newman          IVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDMIGVLERIGYHSRNVSEALVGL
    USA300_FPR3757  IVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYIDMIGVLERIGYHSRNVSEALVGL
                    ************************************************************

    COL             NDDVPTDEEIATTEI
    N315            NDDVPTDEEIATTEI
    NCTC8325        NDDVPTDEEIATTEI
    Newman          NDDVPTDEEIATTEI
    USA300_FPR3757  NDDVPTDEEIATTEI
                    ***************