From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000904000
  • symbol?: norG
  • description?: PLP-dependent aminotransferase family protein

      descriptions from strain specific annotations:

    • PLP-dependent aminotransferase family protein
    • GntR family transcriptional regulator
    • aspartate aminotransferase
    • transcriptional regulator GntR family protein
    • aminotransferase class I and II family protein
    • class I and II aminotransferase
    • GntR family transcriptional regulator domain /Aspartate aminotransferase
    • HTH-type transcriptional regulator NorG
    • putative transcriptional regulator
    • transcription regulator GntR
    • truncated Transcriptional regulator, GntR family
  • strand?: +
  • coordinates?: 1169617..1170622
  • synteny block?: BlockID0004410
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0108
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_64
    ED133:
    ED98:
    SAAV_0075
    HO 5096 0412:
    JH1:
    SaurJH1_0099
    JH9:
    SaurJH9_0095
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00830 (norG)
    M013:
    M013TW_0097
    MRSA252:
    MSHR1132:
    SAMSHR1132_00840
    MSSA476:
    Mu3:
    SAHV_0107
    Mu50:
    SAV0108
    MW2:
    RF122:
    SAB0047
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0119
    VC40:
    SAVC_00280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKYKDIASDIRDKIITGDWFYGMKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKV
    N315            -----------------------MKIPPQRQLAIQYNVNRVTIIKSIELLEAEGFIYTKV
    NCTC8325        MAKYKDIASDIRDKIITGDWFYGMKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKV
    Newman          MAKYKDIASDIRDKIITGDWFYGMKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKV
    USA300_FPR3757  MAKYKDIASDIRDKIITGDWFYGMKIPSHRQLAIQYNVNRVTIIKSIELLEAEGFIYTKV
                                           ****.:*******************************

    COL             GSGTYVNDYLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLM
    N315            GSGTYVNDYLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLM
    NCTC8325        GSGTYVNDYLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLM
    Newman          GSGTYVNDYLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLM
    USA300_FPR3757  GSGTYVNDYLNEAHITNKWSEMMLWSSQQRSQYTVQLINKIETDDSYIHISKGELGISLM
                    ************************************************************

    COL             PHIQLKKAMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALH
    N315            PHIQLKKAMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALH
    NCTC8325        PHIQLKKAMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALH
    Newman          PHIQLKKAMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALH
    USA300_FPR3757  PHIQLKKAMSNTASHIEDLSFGYNNGYGYIKLRDIIVERMSKQGINVGRENVMITSGALH
                    ************************************************************

    COL             AIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEIDTIIDRFINFKN
    N315            AIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEINTIIDRFINFKN
    NCTC8325        AIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEIDTIIDRFINFKN
    Newman          AIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEIDTIIDRFINFKN
    USA300_FPR3757  AIQLLSIGFLGQDAIIISNTPSYIHSTNVFEQLNFRHIDVPYNQINEIDTIIDRFINFKN
                    ************************************************:***********

    COL             KAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPSIKTYDKL
    N315            KAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPAIKTYDKL
    NCTC8325        KAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPSIKTYDKL
    Newman          KAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPSIKTYDKL
    USA300_FPR3757  KAIYIEPRFNNPTGRSLTNEQKKNIITYSERHNIPIIEDDIFRDIFFSDPTPSIKTYDKL
                    ****************************************************:*******

    COL             GKVIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSY
    N315            GKVIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSY
    NCTC8325        GKVIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSY
    Newman          GKVIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSY
    USA300_FPR3757  GKVIHISSFSKTIAPAIRIGWIVASEKIIEQLADVRMQIDYGSSILSQMVVYEMLKNKSY
                    ************************************************************

    COL             DKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLS
    N315            DKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLS
    NCTC8325        DKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLS
    Newman          DKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLS
    USA300_FPR3757  DKHLVKLRYVLKDKRDFMLNILNNLFKDIAHWEVPSGGYFVWLVFKIDIDIKYLFYELLS
                    ************************************************************

    COL             KEKILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV
    N315            KEKILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV
    NCTC8325        KEKILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV
    Newman          KEKILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV
    USA300_FPR3757  KEKILINPGYIYGSKEKSIRLSFAFESNENIKHALYKIYTYVKKV
                    *********************************************