From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000913000
  • symbol?: sirA
  • description?: iron ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • iron ABC transporter substrate-binding protein
    • iron compound ABC transporter iron compound-binding protein SirA
    • lipoprotein
    • periplasmic binding protein
    • siderophore compound ABC transporter binding protein
    • Siderophore staphylobactin ABC transporter, substrate-binding protein SirA
    • disulfide bond formation regulator protein SirA
    • iron (Fe3+) ABC superfamily ATP binding cassette transporter, binding protein
    • iron (Fe3+) ABC transporter binding protein
    • iron compound ABC transporter, iron compound-binding protein SirA
    • iron-regulated ABC transporter siderophore-binding protein SirA
    • iron-regulated lipoprotein
    • periplasmic binding family protein
    • Staphylobactin-binding protein
  • strand?: -
  • coordinates?: 1181645..1182619
  • synteny block?: BlockID0004500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0099 (sirA)
    N315:
    SA0111 (sirA)
    NCTC8325:
    Newman:
    NWMN_0059 (sirA)
    USA300_FPR3757:
    04-02981:
    SA2981_0116 (sirA)
    08BA02176:
    C248_0103 (sirA)
    11819-97:
    MS7_0107 (sirA)
    71193:
    ST398NM01_0126
    ECT-R 2:
    ECTR2_71
    ED133:
    SAOV_0062 (sirA)
    ED98:
    SAAV_0083 (sirA)
    HO 5096 0412:
    SAEMRSA15_00810 (sirA)
    JH1:
    SaurJH1_0106
    JH9:
    SaurJH9_0102
    JKD6008:
    SAA6008_00093 (sirA)
    JKD6159:
    SAA6159_00098 (sirA)
    LGA251:
    SARLGA251_00900 (sirA)
    M013:
    M013TW_0105
    MRSA252:
    SAR0118 (sirA)
    MSHR1132:
    SAMSHR1132_00910
    MSSA476:
    SAS0089
    Mu3:
    SAHV_0114 (sirA)
    Mu50:
    SAV0115 (sirA)
    MW2:
    MW0088 (sirA)
    RF122:
    SAB0054c (sirA)
    ST398:
    SAPIG0126
    T0131:
    SAT0131_00101 (mecR1)
    TCH60:
    HMPREF0772_10382 (sirA)
    TW20:
    SATW20_01270 (sirA)
    USA300_TCH1516:
    USA300HOU_0126 (sirA)
    VC40:
    SAVC_00315

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLY
    N315            MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLY
    NCTC8325        MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLY
    Newman          MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLY
    USA300_FPR3757  MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLY
                    ************************************************************

    COL             QGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIV
    N315            QGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIV
    NCTC8325        QGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIV
    Newman          QGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIV
    USA300_FPR3757  QGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIV
                    ************************************************************

    COL             ASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQ
    N315            ASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQ
    NCTC8325        ASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQ
    Newman          ASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQ
    USA300_FPR3757  ASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQ
                    ************************************************************

    COL             KDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQ
    N315            KDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQ
    NCTC8325        KDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQ
    Newman          KDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQ
    USA300_FPR3757  KDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQ
                    ************************************************************

    COL             LTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDE
    N315            LTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDE
    NCTC8325        LTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDE
    Newman          LTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDE
    USA300_FPR3757  LTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDE
                    ************************************************************

    COL             ITWNLAGGYKSSLKLIDDLYEKLNIEKQSK
    N315            ITWNLAGGYKSSLKLIDDLYEKLNIEKQSK
    NCTC8325        ITWNLAGGYKSSLKLIDDLYEKLNIEKQSK
    Newman          ITWNLAGGYKSSLKLIDDLYEKLNIEKQSK
    USA300_FPR3757  ITWNLAGGYKSSLKLIDDLYEKLNIEKQSK
                    ******************************