From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0099 [new locus tag: SACOL_RS00490 ]
  • pan locus tag?: SAUPAN000913000
  • symbol: sirA
  • pan gene symbol?: sirA
  • synonym:
  • product: iron compound ABC transporter iron compound-binding protein SirA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0099 [new locus tag: SACOL_RS00490 ]
  • symbol: sirA
  • product: iron compound ABC transporter iron compound-binding protein SirA
  • replicon: chromosome
  • strand: -
  • coordinates: 112438..113430
  • length: 993
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    ATGAATAAAGTAATTAAAATGCTTGTTGTTACGCTTGCTTTCCTACTTGTTTTAGCAGGA
    TGTAGTGGGAATTCAAATAAACAATCATCTGATAACAAAGATAAGGAAACAACTTCAATT
    AAACATGCAATGGGTACAACTGAAATTAAAGGGAAACCAAAGCGTGTTGTTACGCTATAT
    CAAGGTGCCACTGACGTCGCTGTATCTTTAGGTGTTAAACCTGTAGGTGCTGTAGAATCA
    TGGACACAAAAACCGAAATTCGAATACATAAAAAATGATTTAAAAGATACTAAGATTGTA
    GGTCAAGAACCTGCACCTAACTTAGAGGAAATCTCTAAATTAAAACCGGACTTAATTGTC
    GCGTCAAAAGTTAGAAATGAAAAAGTTTACGATCAATTATCTAAAATCGCACCAACAGTT
    TCTACTGATACAGTTTTCAAATTCAAAGATACAACTAAGTTAATGGGGAAAGCTTTAGGG
    AAAGAAAAAGAAGCTGAAGATTTACTTAAAAAGTACGATGATAAAGTAGCTGCATTCCAA
    AAAGATGCAAAAGCAAAGTATAAAGATGCATGGCCATTGAAAGCTTCAGTTGTTAACTTC
    CGTGCTGATCATACAAGAATTTATGCTGGTGGATATGCTGGTGAAATCTTAAATGATTTA
    GGATTCAAACGTAATAAAGACTTACAAAAACAAGTTGATAATGGTAAAGATATTATCCAA
    CTTACATCTAAAGAAAGCATTCCATTAATGAACGCTGATCATATTTTTGTAGTAAAATCA
    GATCCAAATGCGAAAGATGCTGCATTAGTTAAAAAGACTGAAAGCGAATGGACTTCAAGT
    AAAGAGTGGAAAAATTTAGACGCAGTTAAAAACAACCAAGTATCTGATGATTTAGATGAA
    ATCACTTGGAACTTAGCTGGCGGATATAAATCTTCATTAAAACTTATTGACGATTTATAT
    GAAAAGTTAAATATTGAAAAACAATCAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    993

Protein[edit source | edit]

Protein Data Bank: 3MWF
Protein Data Bank: 3MWG

General[edit source | edit]

  • locus tag: SACOL0099 [new locus tag: SACOL_RS00490 ]
  • symbol: SirA
  • description: iron compound ABC transporter iron compound-binding protein SirA
  • length: 330
  • theoretical pI: 9.7617
  • theoretical MW: 36743.9
  • GRAVY: -0.563636

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 61.7)
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 30.5)
    Cellular processesCellular processesSporulation and germinationsporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 16)
    proposed F420-0 ABC transporter, periplasmic F420-0 binding protein (TIGR03868; HMM-score: 14.2)
    MetabolismCentral intermediary metabolismSulfur metabolismphosphoadenosine phosphosulfate reductase (TIGR02057; EC 1.8.4.8; HMM-score: 14)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 13.2)
  • TheSEED:  
    Iron acquisition and metabolismSiderophoresSiderophore Staphylobactin Siderophore staphylobactin ABC transporter, substrate-binding protein SirA 
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 89.6)
    no clan definedETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LVLAGCS
  • SignalP: Signal peptide length 28 aa
    • Ymax: 0.455
    • Ymax_pos: 28
    • Cmax: 0.265
    • Cmax_pos: 31
    • Smax: 0.959
    • Smax_pos: 18
    • Smean: 0.903
    • D: 0.63
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIVASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQKDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNGKDIIQLTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDEITWNLAGGYKSSLKLIDDLYEKLNIEKQSK

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS ONE: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J. Proteome Res.: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J. Proteome Res.: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]

Suzanne E Dale, M Tom Sebulsky, David E Heinrichs
Involvement of SirABC in iron-siderophore import in Staphylococcus aureus.
J. Bacteriol.: 2004, 186(24);8356-62
[PubMed:15576785] [WorldCat.org] [DOI] (P p)