From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000915000
  • symbol?: sbnB
  • description?: ornithine cyclodeaminase protein

      descriptions from strain specific annotations:

    • ornithine cyclodeaminase protein
    • Ornithine cyclodeaminase / Siderophore staphylobactin biosynthesis protein SbnB
    • ornithine cyclodeaminase/mu-crystallin family protein
    • ornithine cyclodeaminase, putative
    • 2,3-diaminopropionate biosynthesis protein SbnB
    • putative ornithine cyclodeaminase
    • Ornithine cyclodeaminase family protein
  • strand?: +
  • coordinates?: 1183845..1184855
  • synteny block?: BlockID0004520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0061 (sbnB)
    USA300_FPR3757:
    04-02981:
    SA2981_0118 (sbnB)
    08BA02176:
    C248_0105
    11819-97:
    MS7_0109
    71193:
    ST398NM01_0128
    ECT-R 2:
    ECTR2_73
    ED133:
    SAOV_0064
    ED98:
    SAAV_0085
    HO 5096 0412:
    SAEMRSA15_00830 (sbnB)
    JH1:
    SaurJH1_0108
    JH9:
    SaurJH9_0104
    JKD6008:
    SAA6008_00095
    JKD6159:
    SAA6159_00100
    LGA251:
    SARLGA251_00920 (sbnB)
    M013:
    M013TW_0107
    MRSA252:
    SAR0120
    MSHR1132:
    SAMSHR1132_00930
    MSSA476:
    SAS0091
    Mu3:
    SAHV_0116
    Mu50:
    SAV0117
    MW2:
    MW0090
    RF122:
    SAB0056
    ST398:
    SAPIG0128
    T0131:
    SAT0131_00103
    TCH60:
    HMPREF0772_10380 (ocd2)
    TW20:
    SATW20_01290 (sbnB)
    USA300_TCH1516:
    USA300HOU_0128 (ocd)
    VC40:
    SAVC_00325

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
    N315            MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
    NCTC8325        MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
    Newman          MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
    USA300_FPR3757  MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLKPYLRQDPENGHIADR
                        ********************************************************

    COL             IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
    N315            IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
    NCTC8325        IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
    Newman          IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
    USA300_FPR3757  IIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDPETNYPIAVMEASLISS
                    ************************************************************

    COL             MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
    N315            MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIKRVFVYDQFSEACAR
    NCTC8325        MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
    Newman          MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
    USA300_FPR3757  MRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFDHIERVFVYDQFSEACAR
                    *********************************************:**************

    COL             FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
    N315            FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
    NCTC8325        FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
    Newman          FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
    USA300_FPR3757  FVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIEYDWLQKGAFISNISIMDV
                    ************************************************************

    COL             HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
    N315            HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
    NCTC8325        HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
    Newman          HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
    USA300_FPR3757  HKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALHAELGQLVTGDIPGREDDDE
                    ************************************************************

    COL             IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
    N315            IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
    NCTC8325        IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
    Newman          IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
    USA300_FPR3757  IILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY
                    ************************************