From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000920000
  • symbol?: sbnF
  • description?: IucA/IucC family siderophore biosynthesis protein

      descriptions from strain specific annotations:

    • IucA/IucC family siderophore biosynthesis protein
    • IucC family siderophore biosynthesis protein
    • siderophore biosynthesis IucC family protein
    • IucA/IucC family protein
    • siderophore biosynthesis protein
    • putative siderophore biosynthesis protein
    • siderophore biosynthesis protein, IucC family
    • Siderophore staphylobactin biosynthesis protein SbnF
    • Siderophore synthase
    • siderophore synthetase
  • strand?: +
  • coordinates?: 1189514..1191376
  • synteny block?: BlockID0004570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0065 (sbnF)
    USA300_FPR3757:
    04-02981:
    SA2981_0122 (sbnF)
    08BA02176:
    C248_0109
    11819-97:
    MS7_0113
    71193:
    ST398NM01_0133
    ECT-R 2:
    ECTR2_77
    ED133:
    SAOV_0068
    ED98:
    SAAV_0089
    HO 5096 0412:
    SAEMRSA15_00870
    JH1:
    SaurJH1_0112
    JH9:
    SaurJH9_0108
    JKD6008:
    SAA6008_00099
    JKD6159:
    SAA6159_00104
    LGA251:
    SARLGA251_00960 (sbnF)
    M013:
    M013TW_0111
    MRSA252:
    SAR0124
    MSHR1132:
    SAMSHR1132_00970
    MSSA476:
    SAS0095
    Mu3:
    SAHV_0120
    Mu50:
    SAV0121
    MW2:
    MW0094
    RF122:
    SAB0060
    ST398:
    SAPIG0133
    T0131:
    SAT0131_00107
    TCH60:
    HMPREF0772_10376 (sbnF)
    TW20:
    SATW20_01330 (sbnF)
    USA300_TCH1516:
    USA300HOU_0132
    VC40:
    SAVC_00345

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------------MNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDG
    N315            ------------------------MNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDG
    NCTC8325        MIVVQTLFIHIYQIQFVITRRYRIVNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDG
    Newman          MIVVQTLFIHIYQIQFVITRRYRIVNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDG
    USA300_FPR3757  MIVVQTLFIHIYQIQFVITRRYRIVNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDG
                                            :***********************************

    COL             VGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREVVFTFPKN
    N315            VGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREAVFTFPKN
    NCTC8325        VGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREVVFTFPKN
    Newman          VGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREVVFTFPKN
    USA300_FPR3757  VGHFTIEGHDSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREVVFTFPKN
                    ****************************************************.*******

    COL             DEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFT
    N315            DEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFT
    NCTC8325        DEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFT
    Newman          DEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFT
    USA300_FPR3757  DEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFT
                    ************************************************************

    COL             LSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEAS
    N315            LSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEAS
    NCTC8325        LSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEAS
    Newman          LSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEAS
    USA300_FPR3757  LSDNLKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEAS
                    ************************************************************

    COL             GKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTK
    N315            GKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTK
    NCTC8325        GKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTK
    Newman          GKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTK
    USA300_FPR3757  GKHVNDVEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTK
                    ************************************************************

    COL             YYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDMYLKDELKTVFLGEVLGQSY
    N315            YYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDMYLKDELKTVFLGEVLGQSY
    NCTC8325        YYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDMYLKDELKTVFLGEVLGQSY
    Newman          YYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDMYLKDELKTVFLGEVLGQSY
    USA300_FPR3757  YYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDMYLKDELKTVFLGEVLGQSY
                    ************************************************************

    COL             LNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYG
    N315            LNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGLPFIEKWIKQYG
    NCTC8325        LNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYG
    Newman          LNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYG
    USA300_FPR3757  LNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYG
                    ************************************************:****:******

    COL             SEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKRE
    N315            SEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKRE
    NCTC8325        SEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKRE
    Newman          SEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKRE
    USA300_FPR3757  SEAWTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKRE
                    ************************************************************

    COL             HLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYG
    N315            HLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYG
    NCTC8325        HLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYG
    Newman          HLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYG
    USA300_FPR3757  HLSEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYG
                    ************************************************************

    COL             IDEELQWQWVKGIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
    N315            IDEQRQWQWVKDIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
    NCTC8325        IDEELQWQWVKGIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
    Newman          IDEELQWQWVKGIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
    USA300_FPR3757  IDEELQWQWVKGIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
                    ***: ******.************************************************

    COL             PLGVGGINDATTISET
    N315            PLGVGGINDATTISET
    NCTC8325        PLGVGGINDATTISET
    Newman          PLGVGGINDATTISET
    USA300_FPR3757  PLGVGGINDATTISET
                    ****************