From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000922000
  • symbol?: sbnH
  • description?: diaminopimelate decarboxylase

      descriptions from strain specific annotations:

    • diaminopimelate decarboxylase
    • pyridoxal-dependent decarboxylase
    • alanine racemase
    • diaminopimelate decarboxylase protein
    • Orn/DAP/Arg decarboxylase 2
    • pyridoxal-dependent decarboxylase, C-terminal sheet domain protein
    • pyridoxal-dependent decarboxylase decarboxylase
    • Siderophore staphylobactin biosynthesis protein SbnH
  • strand?: +
  • coordinates?: 1192127..1193329
  • synteny block?: BlockID0004590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0067 (sbnH)
    USA300_FPR3757:
    04-02981:
    SA2981_0124 (sbnH)
    08BA02176:
    C248_0111
    11819-97:
    MS7_0115
    71193:
    ST398NM01_0135
    ECT-R 2:
    ECTR2_79
    ED133:
    SAOV_0070
    ED98:
    SAAV_0091
    HO 5096 0412:
    SAEMRSA15_00890
    JH1:
    SaurJH1_0114
    JH9:
    SaurJH9_0110
    JKD6008:
    SAA6008_00101 (sbnH)
    JKD6159:
    SAA6159_00106 (sbnH)
    LGA251:
    SARLGA251_00980 (sbnH)
    M013:
    M013TW_0113
    MRSA252:
    SAR0126
    MSHR1132:
    SAMSHR1132_00990
    MSSA476:
    SAS0097
    Mu3:
    SAHV_0122
    Mu50:
    SAV0123
    MW2:
    MW0096
    RF122:
    SAB0062
    ST398:
    SAPIG0135
    T0131:
    SAT0131_00109
    TCH60:
    HMPREF0772_10374 (sbnH)
    TW20:
    SATW20_01350 (sbnH)
    USA300_TCH1516:
    USA300HOU_0134 (lysA1)
    VC40:
    SAVC_00355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQMYYAMKANSERKILDT
    N315            MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQMYYAMKANSERTILDT
    NCTC8325        MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQMYYAMKANSERKILDT
    Newman          MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQMYYAMKANSERKILDT
    USA300_FPR3757  MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITSSLPSNCQMYYAMKANSERKILDT
                    *******************************************************.****

    COL             ISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAVSEGVQRIHVESMHELQ
    N315            ISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAVSEGVQRIHVESMHELQ
    NCTC8325        ISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAVSEGVQRIHVESMHELQ
    Newman          ISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAVSEGVQRIHVESMHELQ
    USA300_FPR3757  ISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAVSEGVQRIHVESMHELQ
                    ************************************************************

    COL             RLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISEDEVDDVIEAALAMPKIH
    N315            RLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISEDEVDDVIEAALVMPNIH
    NCTC8325        RLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISEDEVDDVIEAALAMPKIH
    Newman          RLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISEDEVDDVIEAALAMPKIH
    USA300_FPR3757  RLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISEDEVDDVIEAALAMPKIH
                    ******************************************************.**:**

    COL             LDGFHFHSISNNLDSNLHVDVVKLYFKKAKAWSEKHRFPLKHINLGGGIGVNYADLTNQF
    N315            LDGFHFHSISNNLDSNLHVDVVKLYFKKAKSWSEKHRFPLKHINLGGGIGVNYADLTSQF
    NCTC8325        LDGFHFHSISNNLDSNLHVDVVKLYFKKAKAWSEKHRFPLKHINLGGGIGVNYADLTNQF
    Newman          LDGFHFHSISNNLDSNLHVDVVKLYFKKAKAWSEKHRFPLKHINLGGGIGVNYADLTNQF
    USA300_FPR3757  LDGFHFHSISNNLDSNLHVDVVKLYFKKAKAWSEKHRFPLKHINLGGGIGVNYADLTNQF
                    ******************************:**************************.**

    COL             EWDNFVERFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGT
    N315            EWDNFVENFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGT
    NCTC8325        EWDNFVERFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGT
    Newman          EWDNFVERFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGT
    USA300_FPR3757  EWDNFVERFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTEVLDIKKVHGAWYAILRGGT
                    *******.****************************************************

    COL             QQFRLPVSWQHNHPFDIYRYKDNPYSFEKVSISRQDTTLVGQLCTPKDVFAREVQIDAIS
    N315            QQFRLPVSWQHNHPFEIYRYKDNPYSFEKVSISRQDTTLVGQLCTPKDVFAREVQIDAIS
    NCTC8325        QQFRLPVSWQHNHPFDIYRYKDNPYSFEKVSISRQDTTLVGQLCTPKDVFAREVQIDAIS
    Newman          QQFRLPVSWQHNHPFDIYRYKDNPYSFEKVSISRQDTTLVGQLCTPKDVFAREVQIDAIS
    USA300_FPR3757  QQFRLPVSWQHNHPFDIYRYKDNPYSFEKVSISRQDTTLVGQLCTPKDVFAREVQIDAIS
                    ***************:********************************************

    COL             TGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKEDE
    N315            TGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKEDE
    NCTC8325        TGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKEDE
    Newman          TGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKEDE
    USA300_FPR3757  TGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKEDE
                    ****************************************