From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000946000
  • symbol?:
  • description?: regulatory protein GntR

      descriptions from strain specific annotations:

    • regulatory protein GntR
    • GntR family transcriptional regulator
    • regulator for deoxynucleoside utilization, GntR family
    • regulatory proteins, gntR family protein
    • putative regulator for deoxynucleosideutilization, GntR family
    • bacterial regulatory s, gntR family protein
    • transcriptional regulator, GntR family
  • strand?: -
  • coordinates?: 1207496..1208346
  • synteny block?: BlockID0004820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0136
    08BA02176:
    C248_0124
    11819-97:
    MS7_0126
    71193:
    ST398NM01_0149
    ECT-R 2:
    ECTR2_91
    ED133:
    SAOV_0082
    ED98:
    SAAV_0103
    HO 5096 0412:
    SAEMRSA15_01010
    JH1:
    SaurJH1_0126
    JH9:
    SaurJH9_0121
    JKD6008:
    SAA6008_00113
    JKD6159:
    SAA6159_00118
    LGA251:
    SARLGA251_01090
    M013:
    M013TW_0125
    MRSA252:
    SAR0137
    MSHR1132:
    SAMSHR1132_01110
    MSSA476:
    SAS0109
    Mu3:
    SAHV_0134
    Mu50:
    SAV0135
    MW2:
    MW0109
    RF122:
    SAB0074c
    ST398:
    SAPIG0149
    T0131:
    SAT0131_00123 (xylR)
    TCH60:
    HMPREF0772_10363
    TW20:
    SATW20_01460
    USA300_TCH1516:
    USA300HOU_0147
    VC40:
    SAVC_00420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEVVYVTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRMTLRQAIKLLA
    N315            -----MTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRMTLRQAIKLLA
    NCTC8325        MEVVYVTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRMTLRQAIKLLA
    Newman          MEVVYVTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRMTLRQAIKLLA
    USA300_FPR3757  MEVVYVTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRMTLRQAIKLLA
                         :******************************************************

    COL             EDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINYRVDLESEYTNH
    N315            EDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINYRVDLESEYTNH
    NCTC8325        EDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINYRVDLESEYTNH
    Newman          EDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINYRVDLESEYTNH
    USA300_FPR3757  EDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINYRVDLESEYTNH
                    ************************************************************

    COL             LFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQNEDDMKTFVEQTI
    N315            LFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQNEDDMKTFVEQTI
    NCTC8325        LFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQNEDDMKTFVEQTI
    Newman          LFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQNEDDMKTFVEQTI
    USA300_FPR3757  LFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQNEDDMKTFVEQTI
                    ************************************************************

    COL             YSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQTPYPIMINKWYIPQEISE
    N315            YSNAYQSDLKMSITKAPRFKNHSHVFDGDTHCWLIIETLYAQTPYPIMINKWYIPQEISE
    NCTC8325        YSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQTPYPIMINKWYIPQEISE
    Newman          YSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQTPYPIMINKWYIPQEISE
    USA300_FPR3757  YSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQTPYPIMINKWYIPQEISE
                    *****************:******************************************

    COL             LTLTRIRQSDY
    N315            LTLTRIRQSDY
    NCTC8325        LTLTRIRQSDY
    Newman          LTLTRIRQSDY
    USA300_FPR3757  LTLTRIRQSDY
                    ***********