From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000954000
  • symbol?: phnE1
  • description?: phosphonate ABC transporter, permease protein PhnE

      descriptions from strain specific annotations:

    • phosphonate ABC transporter, permease protein PhnE
    • phosphonate ABC transporter permease
    • phosphonates ABC transporter permease
    • binding-protein-dependent transport systems membrane component
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter ATP-binding protein
    • binding-protein-dependent transport system membrane component
    • phosphonate ABC transporter, inner membrane subunit
    • phosphonate ABC transporter inner membrane subunit
    • Phosphonate ABC transporter permease protein phnE1
    • phosphonates ABC transporter permease CC0363
    • phosphonates transport permease
  • strand?: -
  • coordinates?: 1214072..1214887
  • synteny block?: BlockID0004890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0141
    08BA02176:
    C248_0129
    11819-97:
    MS7_0131
    71193:
    ST398NM01_0154
    ECT-R 2:
    ECTR2_96 (phnE)
    ED133:
    SAOV_0087
    ED98:
    SAAV_0108
    HO 5096 0412:
    SAEMRSA15_01060
    JH1:
    SaurJH1_0131
    JH9:
    SaurJH9_0126
    JKD6008:
    SAA6008_00118
    JKD6159:
    SAA6159_00123
    LGA251:
    SARLGA251_01140
    M013:
    M013TW_0130
    MRSA252:
    SAR0142
    MSHR1132:
    SAMSHR1132_01160
    MSSA476:
    SAS0114
    Mu3:
    SAHV_0139
    Mu50:
    SAV0140
    MW2:
    MW0114
    RF122:
    SAB0081c
    ST398:
    SAPIG0154 (phnE)
    T0131:
    SAT0131_00129
    TCH60:
    HMPREF0772_10358 (phnE2)
    TW20:
    SATW20_01510
    USA300_TCH1516:
    USA300HOU_0152
    VC40:
    SAVC_00445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGL
    N315            MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGL
    NCTC8325        MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGL
    Newman          MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGL
    USA300_FPR3757  MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGL
                    ************************************************************

    COL             FHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSK
    N315            FHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSK
    NCTC8325        FHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSK
    Newman          FHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSK
    USA300_FPR3757  FHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSK
                    ************************************************************

    COL             FILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESL
    N315            FILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESL
    NCTC8325        FILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESL
    Newman          FILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESL
    USA300_FPR3757  FILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESL
                    ************************************************************

    COL             KASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTR
    N315            KASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTR
    NCTC8325        KASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTR
    Newman          KASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTR
    USA300_FPR3757  KASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTR
                    ************************************************************

    COL             SWDRVGIILIGLVLMVAIVDLISGSIRKRIV
    N315            SWDRVGIILIGLVLMVAIVDLISGSIRKRIV
    NCTC8325        SWDRVGIILIGLVLMVAIVDLISGSIRKRIV
    Newman          SWDRVGIILIGLVLMVAIVDLISGSIRKRIV
    USA300_FPR3757  SWDRVGIILIGLVLMVAIVDLISGSIRKRIV
                    *******************************