From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0125 [new locus tag: SACOL_RS00630 ]
  • pan locus tag?: SAUPAN000954000
  • symbol: SACOL0125
  • pan gene symbol?: phnE1
  • synonym:
  • product: phosphonate ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL0125 [new locus tag: SACOL_RS00630 ]
  • symbol: SACOL0125
  • product: phosphonate ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 140420..141235
  • length: 816
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACACAGGAAATAGCAAAATATAATGTTCACACAAAAGCACACAAACGAAAATTGATT
    AAAAGATGGCTTATTGCAATTGTCGTCTTAGCTATTATCATCTGGGCATTTGCAGGTGTA
    CCAAGTTTAGAACTTAAAAGTAAATCATTAGAAATCTTAAAATCCATATTCAGCGGATTA
    TTCCATCCTGATATCAGCTATATCTATATACCAGATGGCGAAGACTTATTACGTGGTTTA
    CTTGAAACCTTTGCGATAGCCGTTGTAGGTACTTTCATCGCCGCAATTATCTGTATTCCA
    TTAGCATTTCTAGGTGCAAATAATATGGTAAAGCTACGCCCAGTTTCAGGTGTTAGCAAA
    TTTATTTTAAGTGTTATACGTGTCTTCCCAGAAATTGTAATGGCACTTATATTTATCAAA
    GCTGTTGGCCCAGGTTCATTTTCAGGTGTATTAGCTTTAGGTATCCATTCCGTAGGTATG
    CTTGGGAAACTTTTAGCTGAAGATATTGAAGGTCTAGATTTCAGTGCTGTAGAATCATTA
    AAGGCCAGTGGTGCGAATAAGATTAAAACACTCGTATTTGCAGTCATACCACAAATTATG
    CCTGCCTTTCTATCACTCATACTTTATCGCTTTGAACTAAACTTACGTTCAGCTTCTATA
    CTGGGGCTAATTGGGGCTGGTGGTATCGGGACACCACTCATATTTGCCATTCAAACACGT
    TCTTGGGACCGTGTAGGTATTATATTAATCGGTTTAGTACTAATGGTCGCAATTGTCGAT
    TTAATTTCCGGTTCAATCCGAAAACGTATTGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL0125 [new locus tag: SACOL_RS00630 ]
  • symbol: SACOL0125
  • description: phosphonate ABC transporter permease
  • length: 271
  • theoretical pI: 10.4719
  • theoretical MW: 29286.2
  • GRAVY: 0.926568

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 267.8)
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 24.7)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 21.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesamino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 19.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiamineenergy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 14.5)
    MetabolismTransport and binding proteinsOtherenergy coupling factor transporter S component ThiW (TIGR02359; HMM-score: 14.5)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 9.9)
  • TheSEED:  
    ABC transporter alkylphosphonate (TC 3.A.1.9.1) ABC transporter, permease protein (cluster 12, methionine/phosphonates) 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 46.7)
    no clan definedDUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 9.4)
    DUF5345; Family of unknown function (DUF5345) (PF17280; HMM-score: 9.2)
    SNARE; SNARE domain (PF05739; HMM-score: 8.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.178
    • Ymax_pos: 39
    • Cmax: 0.136
    • Cmax_pos: 39
    • Smax: 0.362
    • Smax_pos: 25
    • Smean: 0.219
    • D: 0.194
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLELKSKSLEILKSIFSGLFHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFLGANNMVKLRPVSGVSKFILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGKLLAEDIEGLDFSAVESLKASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILGLIGAGGIGTPLIFAIQTRSWDRVGIILIGLVLMVAIVDLISGSIRKRIV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]