From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000955000
  • symbol?: phnE2
  • description?: phosphonates transport permease

      descriptions from strain specific annotations:

    • phosphonates transport permease
    • phosphonate ABC transporter, inner membrane subunit
    • phosphonate ABC transporter inner membrane subunit
    • phosphonate ABC transporter permease
    • Phosphonate ABC transporter permease protein phnE2
    • phosphonate ABC transporter, permease protein PhnE
    • binding-protein-dependent transport system membrane component
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • phosphonates ABC transporter permease CC0363
    • ABC transporter ATP-binding protein
    • pseudogene
  • strand?: -
  • coordinates?: 1214884..1215609
  • synteny block?: BlockID0004900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0142
    08BA02176:
    C248_0130
    11819-97:
    MS7_0132
    71193:
    ST398NM01_0155
    ECT-R 2:
    ECTR2_97 (phnE)
    ED133:
    SAOV_0088
    ED98:
    SAAV_0109
    HO 5096 0412:
    SAEMRSA15_01070
    JH1:
    SaurJH1_0132
    JH9:
    SaurJH9_0127
    JKD6008:
    SAA6008_00119
    JKD6159:
    SAA6159_00124
    LGA251:
    SARLGA251_01150
    M013:
    M013TW_0131
    MRSA252:
    SAR0143
    MSHR1132:
    SAMSHR1132_01170
    MSSA476:
    SAS0115
    Mu3:
    SAHV_0140
    Mu50:
    SAV0141
    MW2:
    MW0115
    RF122:
    SAB0082c
    ST398:
    SAPIG0155 (phnE)
    T0131:
    SAT0131_00130
    TCH60:
    HMPREF0772_10357 (phnE)
    TW20:
    SATW20_01520
    USA300_TCH1516:
    USA300HOU_0153
    VC40:
    SAVC_00450

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGDLMIGIPQIGDLFKQM
    N315            MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGDLMIGIPQIGDLFKQM
    NCTC8325        MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGDLMIGIPQIGDLFKQM
    Newman          MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGDLMIGIPQIGDLFKQM
    USA300_FPR3757  MPLEIPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGDLMIGIPQIGDLFKQM
                    ************************************************************

    COL             IPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNIVHQKWISIPSRFILNI
    N315            IPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNIVHQKWISIPSRFILNI
    NCTC8325        IPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNIVHQKWISIPSRFILNI
    Newman          IPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNIVHQKWISIPSRFILNI
    USA300_FPR3757  IPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNIVHQKWISIPSRFILNI
                    ************************************************************

    COL             VRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYESLETIDPGPMEAMTAVGA
    N315            VRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYESLETIDPGPMEAMTAVGA
    NCTC8325        VRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYESLETIDPGPMEAMTAVGA
    Newman          VRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYESLETIDPGPMEAMTAVGA
    USA300_FPR3757  VRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYESLETIDPGPMEAMTAVGA
                    ************************************************************

    COL             NKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAGGIGLFYDQTLGLFQYPKT
    N315            NKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAGGIGLFYDQTLGLFQYPKT
    NCTC8325        NKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAGGIGLFYDQTLGLFQYPKT
    Newman          NKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAGGIGLFYDQTLGLFQYPKT
    USA300_FPR3757  NKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAGGIGLFYDQTLGLFQYPKT
                    ************************************************************

    COL             ATIILFTLVIVVVIDYISTKVRAHLA
    N315            ATIILFTLVIVVVIDYISTKVRAHLA
    NCTC8325        ATIILFTLVIVVVIDYISTKVRAHLA
    Newman          ATIILFTLVIVVVIDYISTKVRAHLA
    USA300_FPR3757  ATIILFTLVIVVVIDYISTKVRAHLA
                    **************************