From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN000977000
  • symbol?: capD
  • description?: polysaccharide biosynthesis protein

      descriptions from strain specific annotations:

    • polysaccharide biosynthesis protein
    • capsular polysaccharide biosynthesis protein Cap5D
    • capsular polysaccharide synthesis protein Cap5D
    • polysaccharide biosynthesis protein CapD
    • capsular polysaccharide biosynthesis protein capD
    • Capsular polysaccharide synthesis enzyme Cap8D
    • capsular polysaccharide synthesis enzyme
    • capsular polysaccharide synthesis enzyme Cap5D
    • capsular polysaccharide synthesis enzyme CapD
    • polysaccharide biosynthesis family protein
    • pseudogene
    • UDP-D-quinovosamine 4-dehydrogenase
  • strand?: +
  • coordinates?: 1232687..1234601
  • synteny block?: BlockID0005110
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0139 (cap5D)
    N315:
    SA0147 (capD)
    NCTC8325:
    Newman:
    NWMN_0098 (capD)
    USA300_FPR3757:
    SAUSA300_0155 (cap5D)
    04-02981:
    SA2981_0153 (capD)
    08BA02176:
    C248_0141 (capD)
    11819-97:
    MS7_0146
    71193:
    ST398NM01_0166
    ECT-R 2:
    ECTR2_109
    ED133:
    SAOV_0099
    ED98:
    SAAV_0120 (cap5D)
    HO 5096 0412:
    SAEMRSA15_01180 (capD)
    JH1:
    SaurJH1_0143
    JH9:
    SaurJH9_0138
    JKD6008:
    SAA6008_00130 (cap5D)
    JKD6159:
    SAA6159_00136 (cap5D)
    LGA251:
    SARLGA251_01260 (capD)
    M013:
    M013TW_0142
    MRSA252:
    SAR0154 (capD)
    MSHR1132:
    SAMSHR1132_01260
    MSSA476:
    SAS0127
    Mu3:
    SAHV_0151 (capD)
    Mu50:
    SAV0152 (capD)
    MW2:
    MW0127 (cap8D)
    RF122:
    SAB0093 (capD)
    ST398:
    SAPIG0166
    T0131:
    SAT0131_00142
    TCH60:
    HMPREF0772_10346 (capD)
    TW20:
    SATW20_01630 (capD)
    USA300_TCH1516:
    VC40:
    SAVC_00530

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----MAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLILAAISLFISHH
    N315            ----MAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLILAAISLFISHH
    NCTC8325        ----MAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLILAAISLFISHH
    Newman          MRGFMAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLILAAISLFISHH
                        ********************************************************

    COL             ISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPFFRLYLITWMMHL
    N315            ISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPFFRLYLITWMMHL
    NCTC8325        ISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPFFRLYLITWMMHL
    Newman          ISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPFFRLYLITWMMHL
                    ************************************************************

    COL             ILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSDEMKLEPVLAVDDD
    N315            ILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSDEMKLEPVLAVDDD
    NCTC8325        ILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSDEMKLEPVLAVDDD
    Newman          ILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSDEMKLEPVLAVDDD
                    ************************************************************

    COL             EHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLKEINNICHMDGVELL
    N315            EHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLKEINNICHMDGVELL
    NCTC8325        EHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLKEINNICHMDGVELL
    Newman          EHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLKEINNICHMDGVELL
                    ************************************************************

    COL             KMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTNKTILVTGAGGSIGSE
    N315            KMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTNKTILVTGAGGSIGSE
    NCTC8325        KMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTNKTILVTGAGGSIGSE
    Newman          KMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTNKTILVTGAGGSIGSE
                    ************************************************************

    COL             ICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPIIADVQNRARMFEIMETY
    N315            ICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPIIADVQNRARMFEIMETY
    NCTC8325        ICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPIIADVQNRARMFEIMETY
    Newman          ICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPIIADVQNRARMFEIMETY
                    ************************************************************

    COL             KPYAVYHAAAHKHVPLMEDNPEEAVRNNILGTKNTAEAAKNAEVKKFVMISTDKAVNPPN
    N315            KPYAVYHAAAHKHVPLMEDNPEEAVHNNILGTKNTAEAAKNAEVKKFVMISTDKAVNPPN
    NCTC8325        KPYAVYHAAAHKHVPLMEDNPEEAVRNNILGTKNTAEAAKNAEVKKFVMISTDKAVNPPN
    Newman          KPYAVYHAAAHKHVPLMEDNPEEAVRNNILGTKNTAEAAKNAEVKKFVMISTDKAVNPPN
                    *************************:**********************************

    COL             VMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIPLFKSQIEEGGPVTVTHPE
    N315            VMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIPLFKSQIEEGGPVTVTHPE
    NCTC8325        VMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIPLFKSQIEEGGPVTVTHPE
    Newman          VMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIPLFKSQIEEGGPVTVTHPE
                    ************************************************************

    COL             MTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDLARNLIKLSGKKEDDIRITY
    N315            MTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDLARNLIKLSGKKEDDIRITY
    NCTC8325        MTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDLARNLIKLSGKKEDDIRITY
    Newman          MTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDLARNLIKLSGKKEDDIRITY
                    ************************************************************

    COL             TGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNEVEAIIQDIVNDFSKEKIINY
    N315            TGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNEVEAIIQDIVNDFSKEKIINY
    NCTC8325        TGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNEVEAIIQDIVNDFSKEKIINY
    Newman          TGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNEVEAIIQDIVNDFSKEKIINY
                    ************************************************************

    COL             ANGKKGDNYVR
    N315            ANGKKGDNYVR
    NCTC8325        ANGKKGDNYVR
    Newman          ANGKKGDNYVR
                    ***********