From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000982000
  • symbol?: capH
  • description?: O-acetyl transferase

      descriptions from strain specific annotations:

    • O-acetyl transferase
    • capsular polysaccharide synthesis enzyme O-acetyl transferase Cap5H
    • capsular polysaccharide synthesis protein O-acetyl transferase Cap5H
    • acetyltransferase
    • capsular polysaccharide biosynthesis protein Cap5H
    • Capsular polysaccharide synthesis enzyme Cap5H
    • chloramphenicol acetyltransferase
    • capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
    • capsular polysaccharide synthesis enzyme O-acetyl transferase CapH
  • strand?: +
  • coordinates?: 1237860..1244537
  • synteny block?: BlockID0005160
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0143 (cap5H)
    N315:
    SA0151 (capH)
    NCTC8325:
    Newman:
    NWMN_0102 (capH)
    USA300_FPR3757:
    SAUSA300_0159 (cap5H)
    04-02981:
    SA2981_0157 (capH)
    08BA02176:
    C248_0145 (capH)
    11819-97:
    71193:
    ST398NM01_0170
    ECT-R 2:
    ECTR2_113
    ED133:
    ED98:
    SAAV_0124 (cap5H)
    HO 5096 0412:
    SAEMRSA15_01220 (cap5H)
    JH1:
    SaurJH1_0147
    JH9:
    SaurJH9_0142
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_01300
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0155 (capH)
    Mu50:
    SAV0156 (capH)
    MW2:
    RF122:
    ST398:
    SAPIG0170
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0170 (cap5H)
    VC40:
    SAVC_00550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGF
    N315            MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGF
    NCTC8325        MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGF
    Newman          MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGF
    USA300_FPR3757  MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGF
                    ************************************************************

    COL             GSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRT
    N315            GSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRT
    NCTC8325        GSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRT
    Newman          GSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRT
    USA300_FPR3757  GSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRT
                    ************************************************************

    COL             TIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIE
    N315            TIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIE
    NCTC8325        TIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIE
    Newman          TIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIE
    USA300_FPR3757  TIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIE
                    ************************************************************

    COL             KLLESKWWEKTPDKLKGFSVEYLNKKDT
    N315            KLLESKWWEKTPDKLKGFSVEYLNKKDT
    NCTC8325        KLLESKWWEKTPDKLKGFSVEYLNKKDT
    Newman          KLLESKWWEKTPDKLKGFSVEYLNKKDT
    USA300_FPR3757  KLLESKWWEKTPDKLKGFSVEYLNKKDT
                    ****************************