From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN000989000
  • symbol?: capK
  • description?: capsular polysaccharide biosynthesis protein Cap5K

      descriptions from strain specific annotations:

    • capsular polysaccharide biosynthesis protein Cap5K
    • capsular polysaccharide biosynthesis protein CapK
    • capsular polysaccharide synthesis protein Cap5K
    • capsular polysaccharide synthesis enzyme
    • capsular polysaccharide synthesis enzyme Cap5K
  • strand?: +
  • coordinates?: 1252687..1258820
  • synteny block?: BlockID0005220
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0146 (cap5K)
    N315:
    SA0154 (capK)
    NCTC8325:
    Newman:
    NWMN_0105 (capK)
    USA300_FPR3757:
    SAUSA300_0162 (cap5K)
    04-02981:
    SA2981_0160 (capK)
    08BA02176:
    C248_0148 (capK)
    11819-97:
    71193:
    ST398NM01_0173
    ECT-R 2:
    ECTR2_116
    ED133:
    ED98:
    SAAV_0127 (cap5K)
    HO 5096 0412:
    SAEMRSA15_01250
    JH1:
    SaurJH1_0150
    JH9:
    SaurJH9_0145
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_01330
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0158 (capK)
    Mu50:
    SAV0159 (capK)
    MW2:
    RF122:
    ST398:
    SAPIG0173
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0173 (cap5K)
    VC40:
    SAVC_00565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKVFIMDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSILTIYTIITITSVVLGN
    N315            MVKKVFIMDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSILTIYTIITITSVVLGN
    NCTC8325        MAKKVFIMDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSILTIYTIITITSVVLGN
    Newman          -------MDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSILTIYTIITITSVVLGN
    USA300_FPR3757  MAKKVFIMDSVKTIIGTLLIALGLQFLAYPIINQRVGNEAFGSILTIYTIITITSVVLGN
                           *****************************************************

    COL             TLNNIRLINMNLYKSNHYYWKFASILLISILIESIALIIVFLYFFNLNIIDIIFLILLNI
    N315            TLNNIRLINMNLYKSNHYYWKFVSILLISILIESIALIIVFLYFFNLNTIDIIFLILLNI
    NCTC8325        TLNNIRLINMNLYKSNHYYWKFASILLISILIESIALIIVFLYFFNLNIIDIIFLILLNI
    Newman          TLNNIRLINMNLYKSNHYYWKFASILLISILIESIALIIVFLYFFNLNIIDIIFLILLNI
    USA300_FPR3757  TLNNIRLINMNLYKSNHYYWKFASILLISILIESIALIIVFLYFFNLNIIDIIFLILLNI
                    **********************.************************* ***********

    COL             LMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLTQNWIVCFITSELFATIYT
    N315            LMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLIQNWIVCFITSELFATIYT
    NCTC8325        LMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLTQNWIVCFITSELFATIYT
    Newman          LMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLTQNWIVCFITSELFATIYT
    USA300_FPR3757  LMCLRIYLNVFFRMTLKYNQILYIALIQFLGLLIGLFLYYLTQNWIVCFITSELFATIYT
                    ***************************************** ******************

    COL             LVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRLILLPIIGGTAVTISFLST
    N315            LVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRLILLPIIGGTAVTISFLST
    NCTC8325        LVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRLILLPIIGGTAVTISFLST
    Newman          LVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRLILLPIIGGTAVTISFLST
    USA300_FPR3757  LVKLRGLTIGEYQSEDNNVVKDYVMLLSTNSLNNLNLYLDRLILLPIIGGTAVTISFLST
                    ************************************************************

    COL             FIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLIAIAALCLVMIICYPITIIIVS
    N315            FIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLFAIAALCLVMIICYPITLIIVS
    NCTC8325        FIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLIAIAALCLVMIICYPITIIIVS
    Newman          FIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLIAIAALCLVMIICYPITIIIVS
    USA300_FPR3757  FIGKMLATFLYPINNVVLSYISVNESDNIKKQYLKTNLIAIAALCLVMIICYPITIIIVS
                    **************************************:****************:****

    COL             LLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASITLQANYMTLHTITFIFITIL
    N315            LLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASITLQANYMTLHTITFIFITIL
    NCTC8325        LLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASITLQANYMTLHTITFIFITIL
    Newman          LLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASITLQANYMTLHTITFIFITIL
    USA300_FPR3757  LLYNIDSSLYSKFIILGNIGVLFNAVSIMIQTLNTKHASITLQANYMTLHTITFIFITIL
                    ************************************************************

    COL             MTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKDVD
    N315            MTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKDVD
    NCTC8325        MTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKDVD
    Newman          MTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKDVD
    USA300_FPR3757  MTIAFGLNGFFWTTLFSNIIKYVILNIIGLKSKFINKKDVD
                    *****************************************