From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001003000
  • symbol?: aldA
  • description?: aldehyde dehydrogenase

      descriptions from strain specific annotations:

    • aldehyde dehydrogenase
    • aldehyde dehydrogenase homologue
    • Aldehyde dehydrogenase B
    • acetaldehyde dehydrogenase 2 (Acetaldehyde dehydrogenaseII) (ACDH-II)
    • aldehyde dehydrogenase-like protein
    • aldehyde dehydrogenase (NAD(+))
    • putative aldehyde dehydrogenase AldA
    • aldehyde dehdydrogenase
  • strand?: +
  • coordinates?: 1271459..1272946
  • synteny block?: BlockID0005310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0154 (aldA1)
    N315:
    SA0162 (aldA)
    NCTC8325:
    Newman:
    NWMN_0113 (aldA)
    USA300_FPR3757:
    04-02981:
    SA2981_0168 (aldA)
    08BA02176:
    C248_0156
    11819-97:
    MS7_0161 (aldA)
    71193:
    ST398NM01_0181
    ECT-R 2:
    ECTR2_131
    ED133:
    SAOV_0114 (aldA1)
    ED98:
    SAAV_0135 (aldA1)
    HO 5096 0412:
    SAEMRSA15_01330
    JH1:
    SaurJH1_0158
    JH9:
    SaurJH9_0153
    JKD6008:
    SAA6008_00145
    JKD6159:
    SAA6159_00151
    LGA251:
    SARLGA251_01410
    M013:
    M013TW_0157
    MRSA252:
    SAR0169
    MSHR1132:
    SAMSHR1132_01410
    MSSA476:
    SAS0142
    Mu3:
    SAHV_0166 (aldA)
    Mu50:
    SAV0167 (aldA)
    MW2:
    MW0142 (aldA)
    RF122:
    SAB0108 (aldA)
    ST398:
    SAPIG0181
    T0131:
    SAT0131_00158
    TCH60:
    HMPREF0772_10331 (aldA)
    TW20:
    SATW20_01780
    USA300_TCH1516:
    USA300HOU_0181 (aldH2)
    VC40:
    SAVC_00605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
    N315            MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
    NCTC8325        MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
    Newman          MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
    USA300_FPR3757  MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
                    ************************************************************

    COL             EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
    N315            EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
    NCTC8325        EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
    Newman          EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
    USA300_FPR3757  EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
                    ************************************************************

    COL             YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
    N315            YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
    NCTC8325        YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
    Newman          YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
    USA300_FPR3757  YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
                    ************************************************************

    COL             IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
    N315            IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
    NCTC8325        IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
    Newman          IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
    USA300_FPR3757  IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
                    ************************************************************

    COL             QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
    N315            QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
    NCTC8325        QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
    Newman          QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
    USA300_FPR3757  QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
                    ************************************************************

    COL             KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
    N315            KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
    NCTC8325        KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
    Newman          KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
    USA300_FPR3757  KIYDQLVPRLQEAFSNIKVGNPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
                    ********************:***************************************

    COL             RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
    N315            RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
    NCTC8325        RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
    Newman          RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
    USA300_FPR3757  RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
                    ************************************************************

    COL             GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
    N315            GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
    NCTC8325        GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
    Newman          GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
    USA300_FPR3757  GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
                    ************************************************************

    COL             KNIYIDTSNALKGLY
    N315            KNIYIDTSNALKGLY
    NCTC8325        KNIYIDTSNALKGLY
    Newman          KNIYIDTSNALKGLY
    USA300_FPR3757  KNIYIDTSNALKGLY
                    ***************