From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001005000
  • symbol?:
  • description?: cation-efflux system membrane protein CzcD

      descriptions from strain specific annotations:

    • cation-efflux system membrane protein CzcD
    • cation diffusion facilitator family transporter
    • cation efflux family protein
    • Cobalt-zinc-cadmium resistance protein
    • cation diffusion facilitator family transporter family protein
    • cation efflux system protein
    • cation diffusion facilitator transporter family protein
    • CDF family cation diffusion facilitator
    • putative cation efflux system protein
  • strand?: +
  • coordinates?: 1273536..1274601
  • synteny block?: BlockID0005330
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0169
    08BA02176:
    C248_0158
    11819-97:
    MS7_0162
    71193:
    ST398NM01_0183
    ECT-R 2:
    ECTR2_132
    ED133:
    SAOV_0115
    ED98:
    SAAV_0136
    HO 5096 0412:
    SAEMRSA15_01340
    JH1:
    SaurJH1_0159
    JH9:
    SaurJH9_0154
    JKD6008:
    SAA6008_00146
    JKD6159:
    SAA6159_00152
    LGA251:
    SARLGA251_01420
    M013:
    M013TW_0158
    MRSA252:
    SAR0170
    MSHR1132:
    SAMSHR1132_01420
    MSSA476:
    SAS0143
    Mu3:
    SAHV_0167
    Mu50:
    SAV0168
    MW2:
    MW0143
    RF122:
    SAB0109
    ST398:
    SAPIG0183
    T0131:
    SAT0131_00159
    TCH60:
    HMPREF0772_10330
    TW20:
    SATW20_01790
    USA300_TCH1516:
    USA300HOU_0182
    VC40:
    SAVC_00610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------------------MNGKKANTINRYKYFHHVNHQKIQQ
    N315            -----------------------------------MNGKKANTINRYKYFHHVNHQKIQQ
    NCTC8325        -----------------------------------MNGKKANTINRYKYFHHVNHQKIQQ
    Newman          MVNYGSININLRSYKELFLKATILNTTHLFRSGKRMNGKKANTINRYKYFHHVNHQKIQQ
    USA300_FPR3757  -----------------------------------MNGKKANTINRYKYFHHVNHQKIQQ
                                                       *************************

    COL             SSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKP
    N315            SSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKP
    NCTC8325        SSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKP
    Newman          SSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKP
    USA300_FPR3757  SSKKTLWASLIITLLFTVIEFVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKP
                    ************************************************************

    COL             TARYTFGYLRFEILAAFLNGLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVN
    N315            TARYTFGYLRFEILVAFLNGLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVN
    NCTC8325        TARYTFGYLRFEILAAFLNGLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVN
    Newman          TARYTFGYLRFEILAAFLNGLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVN
    USA300_FPR3757  TARYTFGYLRFEILAAFLNGLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVN
                    **************.*********************************************

    COL             IILTVILVRSLKQEDNINIQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVIS
    N315            IILTIILVRSLKQEDNINIQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVIS
    NCTC8325        IILTVILVRSLKQEDNINIQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVIS
    Newman          IILTVILVRSLKQEDNINIQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVIS
    USA300_FPR3757  IILTVILVRSLKQEDNINIQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVIS
                    ****:*******************************************************

    COL             LIILRGGYKITRNAWLILMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLS
    N315            LIILRGGYKITRNAWLILMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLS
    NCTC8325        LIILRGGYKITRNAWLILMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLS
    Newman          LIILRGGYKITRNAWLILMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLS
    USA300_FPR3757  LIILRGGYKITRNAWLILMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLS
                    ************************************************************

    COL             AHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT
    N315            AHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT
    NCTC8325        AHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT
    Newman          AHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT
    USA300_FPR3757  AHVVLDKKYEGDDYQAIDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT
                    ******************************************************