From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001011000
  • symbol?: ssuA
  • description?: putative lipoprotein

      descriptions from strain specific annotations:

    • putative lipoprotein
    • ABC superfamily ABC superfamily ATP binding cassette transporter, binding protein
    • ABC superfamily ATP-binding cassette transporter, binding protein
    • ABC transporter ATP-binding protein
    • ABC transporter substrate-binding protein
    • ABC-type nitrate/sulfonate/bicarbonate transporter, TauA
    • lipoprotein, putative
    • NLPA lipoprotein
    • pseudogene
  • strand?: +
  • coordinates?: 1276271..1278011
  • synteny block?: BlockID0005390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0174
    08BA02176:
    C248_0162
    11819-97:
    MS7_0166
    71193:
    ST398NM01_0187
    ECT-R 2:
    ECTR2_136
    ED133:
    SAOV_0119
    ED98:
    SAAV_0140
    HO 5096 0412:
    SAEMRSA15_01380
    JH1:
    SaurJH1_0163
    JH9:
    SaurJH9_0158
    JKD6008:
    SAA6008_00150 (tauA)
    JKD6159:
    SAA6159_00156 (tauA)
    LGA251:
    SARLGA251_01460
    M013:
    M013TW_0162
    MRSA252:
    SAR0174
    MSHR1132:
    SAMSHR1132_01460
    MSSA476:
    SAS0148
    Mu3:
    SAHV_0172
    Mu50:
    SAV0173
    MW2:
    MW0147
    RF122:
    SAB0113
    ST398:
    SAPIG0187
    T0131:
    SAT0131_00163
    TCH60:
    HMPREF0772_10326
    TW20:
    SATW20_01830
    USA300_TCH1516:
    USA300HOU_0186
    VC40:
    SAVC_00630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKRLSIIVIIGIFIITGCDWQRTSKEPSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQY
    NCTC8325        MKRLSIIVIIGIFIITGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQY
    Newman          MKRLSIIVIIGIFIITGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQY
    USA300_FPR3757  MKRLSIIVIIGIFIITGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQY
                    ************************** *********************************

    N315            NHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVI
    NCTC8325        NHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVI
    Newman          NHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVI
    USA300_FPR3757  NHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKGSNIKAVALGHHEGNVI
                    ************************************************************

    N315            MGQKGMHLNEF-NNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEMPAA
    NCTC8325        MGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEMPAA
    Newman          MGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEMPAA
    USA300_FPR3757  MGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIKPGHFSYHEMSPAEMPAA
                    *********** ************************************************

    N315            LSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAF
    NCTC8325        LSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAF
    Newman          LSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAF
    USA300_FPR3757  LSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAF
                    ************************************************************

    N315            VQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQ
    NCTC8325        VQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQ
    Newman          VQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQ
    USA300_FPR3757  VQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSYGDLTIKPSGYQEITTLVKQ
                    ************************************************************

    N315            HHLFNPPAYDDFVEPSLYKEASRS
    NCTC8325        HHLFNPPAYDDFVEPSLYKEASRS
    Newman          HHLFNPPAYDDFVEPSLYKEASRS
    USA300_FPR3757  HHLFNPPAYDDFVEPSLYKEASRS
                    ************************