From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001018000
  • symbol?: ausA
  • description?: surfactin synthetase

      descriptions from strain specific annotations:

    • surfactin synthetase
    • thioester reductase domain-containing protein
    • gramicidin S synthetase 2 related protein
    • non-ribosomal peptide-like protein and polyketide synthesis
    • non-ribosomal peptide synthetase
    • putative non-ribosomal peptide synthetase
    • surfactin/siderophore synthetase
    • protein related to non-ribosomal peptide and polyketidesynthesis
    • surfactin/siderphore synthesase
    • aureusimine non-ribosomal peptide synthetase
    • Surfactin synthetase subunit 2
  • strand?: +
  • coordinates?: 1284181..1291617
  • synteny block?: BlockID0005460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0180
    08BA02176:
    C248_0168
    11819-97:
    MS7_0172
    71193:
    ST398NM01_0193
    ECT-R 2:
    ECTR2_142
    ED133:
    SAOV_0123
    ED98:
    SAAV_0147
    HO 5096 0412:
    SAEMRSA15_01440
    JH1:
    SaurJH1_0169
    JH9:
    SaurJH9_0164
    JKD6008:
    SAA6008_00157 (ausA)
    JKD6159:
    SAA6159_00160 (ausA)
    LGA251:
    SARLGA251_01500
    M013:
    M013TW_0166
    MRSA252:
    SAR0180
    MSHR1132:
    SAMSHR1132_01520
    MSSA476:
    SAS0154
    Mu3:
    SAHV_0178
    Mu50:
    SAV0179
    MW2:
    MW0153
    RF122:
    SAB0119
    ST398:
    SAPIG0193
    T0131:
    SAT0131_00170
    TCH60:
    HMPREF0772_10320
    TW20:
    SATW20_01890
    USA300_TCH1516:
    USA300HOU_0192
    VC40:
    SAVC_00660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYALSTIVQQHASIRHFF
    N315            MIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYALSTIVQQHASIRHFF
    NCTC8325        MIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYALSTIVQQHASIRHFF
    Newman          --MGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYALSTIVQQHASIRHFF
    USA300_FPR3757  MIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYALSTIVQQHASIRHFF
                      **********************************************************

    COL             DVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTYHFNDSPLFKVKLFQFA
    N315            DVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTYHFNDSPLFKVKLFQFA
    NCTC8325        DVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTYHFNDSPLFKVKLFQFA
    Newman          DVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTYHFNDSPLFKVKLFQFA
    USA300_FPR3757  DVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTYHFNDSPLFKVKLFQFA
                    ************************************************************

    COL             DAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHAHINRNDDKDNQDASHIA
    N315            DAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHAHINRNDDKDNQDASHIA
    NCTC8325        DAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHAHINRNDDKDNQDASHIA
    Newman          DAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHAHINRNDDKDNQDASHIA
    USA300_FPR3757  DAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHAHINRNDDKDNQDASHIA
                    ************************************************************

    COL             LDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSIDMASLAVSVYLANHIMSQ
    N315            LDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSIDMASLAVSVYLANHIMSQ
    NCTC8325        LDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSIDMASLAVSVYLANHIMSQ
    Newman          LDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSIDMASLAVSVYLANHIMSQ
    USA300_FPR3757  LDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSIDMASLAVSVYLANHIMSQ
                    ************************************************************

    COL             QHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTDFNKCVLQNMSQLQCAKSSL
    N315            QHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTDFNKCVLQNMSQLQCAKSSL
    NCTC8325        QHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTDFNKCVLQNMSQLQCAKSSL
    Newman          QHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTDFNKCVLQNMSQLQCAKSSL
    USA300_FPR3757  QHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTDFNKCVLQNMSQLQCAKSSL
                    ************************************************************

    COL             SLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFPHQHGFKIIYNSAAYDLLSIE
    N315            SLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFPHQHGFKIIYNSAAYDLLSIE
    NCTC8325        SLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFPHQHGFKIIYNSAAYDLLSIE
    Newman          SLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFPHQHGFKIIYNSAAYDLLSIE
    USA300_FPR3757  SLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFPHQHGFKIIYNSAAYDLLSIE
                    ************************************************************

    COL             TLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYDDINLSLPEIDDAQTVVTLFEQ
    N315            TLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYDDINLSLPEIDDAQTVVTLFEQ
    NCTC8325        TLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYDDINLSLPEIDDAQTVVTLFEQ
    Newman          TLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYDDINLSLPEIDDAQTVVTLFEQ
    USA300_FPR3757  TLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYDDINLSLPEIDDAQTVVTLFEQ
                    ************************************************************

    COL             QVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQYGVEPNDRVAVIAEKSIEMIIAM
    N315            QVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQYGVEPNDRVAVIAEKSIEMIIAM
    NCTC8325        QVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQYGVEPNDRVAVIAEKSIEMIIAM
    Newman          QVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQYGVEPNDRVAVIAEKSIEMIIAM
    USA300_FPR3757  QVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQYGVEPNDRVAVIAEKSIEMIIAM
                    ************************************************************

    COL             IGVLKAGGAYVPIDPNYPSDRQEYILKDVTPKVVITYQALYENGKQNINHIDLNKIAWKN
    N315            IGVLKAGGAYVPIDPNYPSDRQEYILKDATPKVVITYQALYENGKQNINHIDLNKIAWKN
    NCTC8325        IGVLKAGGAYVPIDPNYPSDRQEYILKDVTPKVVITYQALYENGKQNINHIDLNKIAWKN
    Newman          IGVLKAGGAYVPIDPNYPSDRQEYILKDVTPKVVITYQALYENGKQNINHIDLNKIAWKN
    USA300_FPR3757  IGVLKAGGAYVPIDPNYPSDRQEYILKDVTPKVVITYQALYENGKQNINHIDLNKIAWKN
                    ****************************.*******************************

    COL             IDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGIVRLVHQNHYVPLNEETTILLSGTI
    N315            IDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGIVRLVHRNHYVPLNEETTILLSGTI
    NCTC8325        IDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGIVRLVHQNHYVPLNEETTILLSGTI
    Newman          IDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGIVRLVHQNHYVPLNEETTILLSGTI
    USA300_FPR3757  IDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGIVRLVHQNHYVPLNEETTILLSGTI
                    *****************************************:******************

    COL             AFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQLINENDVNTMWLTSSLFNQIASERI
    N315            AFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQLINENDVNTMWLTSSLFNQIASERI
    NCTC8325        AFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQLINENDVNTMWLTSSLFNQIASERI
    Newman          AFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQLINENDVNTMWLTSSLFNQIASERI
    USA300_FPR3757  AFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQLINENDVNTMWLTSSLFNQIASERI
                    ************************************************************

    COL             EVLVSLKYLLIGGEVLNAKWVDLLNQKPKHPQIINGYGPTENTTFTTTYNIPNKVPNRIP
    N315            EVLVPLKYLLIGGEVLNAKWVDLLNQKPKHPQIINGYGPTENTTFTTTYNIPNKVPNRIP
    NCTC8325        EVLVPLKYLLIGGEVLNAKWVDLLNQKPKHPQIINGYGPTENTTFTTTYNIPNKVPNRIP
    Newman          EVLVPLKYLLIGGEVLNAKWVDLLNQKPKHPQIINGYGPTENTTFTTTYNIPNKVPNRIP
    USA300_FPR3757  EVLVPLKYLLIGGEVLNAKWVDLLNQKPKHPQIINGYGPTENTTFTTTYNIPNKVPNRIP
                    ****.*******************************************************

    COL             IGKPILGTHVYIMQGERRCGVGIPGELCTSGFGLAAGYLNQPELTADKFIKDSNINQLMY
    N315            IGKPILGTHVYIMQGERRCGVGIPGELCTSGFGLAAGYLNQPELTADKFIKDSNINQLMY
    NCTC8325        IGKPILGTHVYIMQGERRCGVGIPGELCTSGFGLAAGYLNQPELTADKFIKDSNINQLMY
    Newman          IGKPILGTHVYIMQGERRCGVGIPGELCTSGFGLAAGYLNQPELTADKFIKDSNINQLMY
    USA300_FPR3757  IGKPILGTHVYIMQGERRCGVGIPGELCTSGFGLAAGYLNQPELTADKFIKDSNINQLMY
                    ************************************************************

    COL             RSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIELSEVEHALERIQGINKAVVIVQNHDQDQ
    N315            RSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIELSEVEHALERIQGINKAVVIVQNHDQDQ
    NCTC8325        RSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIELSEVEHALERIQGINKAVVIVQNHDQDQ
    Newman          RSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIELSEVEHALERIQGINKAVVIVQNHDQDQ
    USA300_FPR3757  RSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIELSEVEHALERIQGINKAVVIVQNHDQDQ
                    ************************************************************

    COL             YIVAYYEAMHTLSHNKIKSQLRMTLPEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVD
    N315            YIVAYYEAMHTLSHNKIKSQLRMTLPEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVD
    NCTC8325        YIVAYYEAMHTLSHNKIKSQLRMTLPEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVD
    Newman          YIVAYYEAMHTLSHNKIKSQLRMTLPEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVD
    USA300_FPR3757  YIVAYYEAMHTLSHNKIKSQLRMTLPEYMIPVNFMHIEQIPITINGKLDKKALPIMDYVD
                    ************************************************************

    COL             TDAYVAPSTDTEHLLCQIFADILHVNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQ
    N315            TDAYVAPSTDTEHLLCQIFADILHVNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQ
    NCTC8325        TDAYVAPSTDTEHLLCQIFADILHVNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQ
    Newman          TDAYVAPSTDTEHLLCQIFADILHVNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQ
    USA300_FPR3757  TDAYVAPSTDTEHLLCQIFADILHVNQVGIHDNFFELGGHSLKATLVVNRIEASTGKRLQ
                    ************************************************************

    COL             IGDLLQKPTVFELAQAIAKVQEQNYEVIPETIVKDDYVLSSAQKRMYLLWKSNHKDTVYN
    N315            IGDLLQKPTVFELAQAIAKVQEQNYEVIPEAIVKDDYVLSSAQKRMYLLWKSNHKDTVYN
    NCTC8325        IGDLLQKPTVFELAQAIAKVQEQNYEVIPETIVKDDYVLSSAQKRMYLLWKSNHKDTVYN
    Newman          IGDLLQKPTVFELAQAIAKVQEQNYEVIPETIVKDDYVLSSAQKRMYLLWKSNHKDTVYN
    USA300_FPR3757  IGDLLQKPTVFELAQAIAKVQEQNYEVIPETIVKDDYVLSSAQKRMYLLWKSNHKDTVYN
                    ******************************:*****************************

    COL             VPFLWRLSSELNVAQLRQAVQRLIARHEILRTQYIVVDDEVRQRIVADVAVDFEEVNTHF
    N315            VPFLWRLSSGLNVAQLQQAVQHLIARHEILRTQYIVVDDEVRQRIVADVVADFEEVNTHF
    NCTC8325        VPFLWRLSSELNVAQLRQAVQRLIARHEILRTQYIVVDDEVRQRIVADVAVDFEEVNTHF
    Newman          VPFLWRLSSELNVAQLRQAVQRLIARHEILRTQYIVVDDEVRQRIVADVAVDFEEVNTHF
    USA300_FPR3757  VPFLWRLSSELNVAQLRQAVQRLIARHEILRTQYIVVDDEVRQRIVADVAVDFEEVNTHF
                    ********* ******:****:***************************..*********

    COL             TDEQEIMRQFVAPFNLEKPSQIRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALY
    N315            TDEQEIMRQFVAPFNLEKPSQIRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALY
    NCTC8325        TDEQEIMRQFVAPFNLEKPSQIRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALY
    Newman          TDEQEIMRQFVAPFNLEKPSQIRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALY
    USA300_FPR3757  TDEQEIMRQFVAPFNLEKPSQIRVRYIRSPLHAYLFIDTHHIINDGMSNIQLMNDLNALY
                    ************************************************************

    COL             QHKLLLPLKLQYKDYSEWMSHRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAM
    N315            QHKLLLPLKLQYKDYSEWMSHRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAM
    NCTC8325        QHKLLLPLKLQYKDYSEWMSHRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAM
    Newman          QHKLLLPLKLQYKDYSEWMSHRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAM
    USA300_FPR3757  QHKLLLPLKLQYKDYSEWMSHRDMTKHRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAM
                    ************************************************************

    COL             MSFTMNQQMRQLLQKYVEKHQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTE
    N315            MSFTMNQQMRQLLQKYVEKHQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTE
    NCTC8325        MSFTMNQQMRQLLQKYVEKHQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTE
    Newman          MSFTMNQQMRQLLQKYVEKHQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTE
    USA300_FPR3757  MSFTMNQQMRQLLQKYVEKHQITDFMFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTE
                    ************************************************************

    COL             QMLGMFANTLVYRGQPSPDKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRN
    N315            QMLGMFANTLVYRGQPSPDKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRN
    NCTC8325        QMLGMFANTLVYRGQPSPDKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRN
    Newman          QMLGMFANTLVYRGQPSPDKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRN
    USA300_FPR3757  QMLGMFANTLVYRGQPSPDKMWTQFLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRN
                    ************************************************************

    COL             PLFDVMLVLQNNETNHAHFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLY
    N315            PLFDVMLVLQNNETNHAHFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLY
    NCTC8325        PLFDVMLVLQNNETNHAHFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLY
    Newman          PLFDVMLVLQNNETNHAHFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLY
    USA300_FPR3757  PLFDVMLVLQNNETNHAHFGHSKLTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLY
                    ************************************************************

    COL             HSETVRHMGNQCMIMIDYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSII
    N315            HSETVRHMGNQCMIMIDYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSII
    NCTC8325        HSETVRHMGNQCMIMIDYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSII
    Newman          HSETVRHMGNQCMIMIDYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSII
    USA300_FPR3757  HSETVRHMGNQCMIMIDYILKHQDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSII
                    ************************************************************

    COL             SYFNEVVSRQGNHVALVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEM
    N315            SYFNEVVSRQGNHVALVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEM
    NCTC8325        SYFNEVVSRQGNHVALVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEM
    Newman          SYFNEVVSRQGNHVALVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEM
    USA300_FPR3757  SYFNEVVSRQGNHVALVMNDLTMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEM
                    ************************************************************

    COL             IAAMLATVKVGASYIPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGF
    N315            IAAMLATVKVGASYIPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGF
    NCTC8325        IAAMLATVKVGASYIPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGF
    Newman          IAAMLATVKVGASYIPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGF
    USA300_FPR3757  IAAMLATVKVGASYIPIDIDFPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGF
                    ************************************************************

    COL             VESKENEQYDDLHGNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTEL
    N315            VESKENEQYDDLHGNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTEL
    NCTC8325        VESKENEQYDDLHGNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTEL
    Newman          VESKENEQYDDLHGNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTEL
    USA300_FPR3757  VESKENEQYDDLHGNQLENTAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTEL
                    ************************************************************

    COL             QLGDNEVFLQHANIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVAS
    N315            QLGDNEVFLQHANIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVAS
    NCTC8325        QLGDNEVFLQHANIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVAS
    Newman          QLGDNEVFLQHANIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVAS
    USA300_FPR3757  QLGDNEVFLQHANIVFDASVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVAS
                    ************************************************************

    COL             IPLQMCSVMEDFYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCG
    N315            IPLQMCSIMEDFYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCG
    NCTC8325        IPLQMCSVMEDFYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCG
    Newman          IPLQMCSVMEDFYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCG
    USA300_FPR3757  IPLQMCSVMEDFYIEKLITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHHCG
                    *******:****************************************************

    COL             DLIPETIPIGKPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNN
    N315            DLIPETIPIGKPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNN
    NCTC8325        DLIPETIPIGKPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNN
    Newman          DLIPETIPIGKPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNN
    USA300_FPR3757  DLIPETIPIGKPLSNIQVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNN
                    ************************************************************

    COL             PFGKGKLYHSGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENAILAIRGISDCVVT
    N315            PFGKGKLYHSGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENVILAIRGISDCVVT
    NCTC8325        PFGKGKLYHSGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENAILAIRGISDCVVT
    Newman          PFGKGKLYHSGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENAILAIRGISDCVVT
    USA300_FPR3757  PFGKGKLYHSGDLARYTSDGQIEFLGRIDKQVKVNGYRIELDEIENAILAIRGISDCVVT
                    **********************************************.*************

    COL             VSHFDTHDILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRL
    N315            VSHFDTHDILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRL
    NCTC8325        VSHFDTHDILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRL
    Newman          VSHFDTHDILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRL
    USA300_FPR3757  VSHFDTHDILNAYYVGEQQVEQDLKQYLNDQLPKYMIPKTITHIDCMPLTTNDKVDTTRL
                    ************************************************************

    COL             PNPSPIQQSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHL
    N315            PNPSPIQQSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHL
    NCTC8325        PNPSPIQQSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHL
    Newman          PNPSPIQQSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHL
    USA300_FPR3757  PNPSPIQQSNKVYSEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHL
                    ************************************************************

    COL             KRFGHHISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLS
    N315            KRFGHHISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLS
    NCTC8325        KRFGHHISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLS
    Newman          KRFGHHISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLS
    USA300_FPR3757  KRFGHHISMQTLYQYKTVRQIVNYMYQNQQSLVALPDNLSELQKIVMSRYNLGILEDSLS
                    ************************************************************

    COL             HRPLGNTLLTGATGFLGAYLIEVLQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETV
    N315            HRPLGNTLLTGATGFLGAYLIEALQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETV
    NCTC8325        HRPLGNTLLTGATGFLGAYLIEVLQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETV
    Newman          HRPLGNTLLTGATGFLGAYLIEVLQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETV
    USA300_FPR3757  HRPLGNTLLTGATGFLGAYLIEVLQGYSHRIYCFIRADNEEIAWYKLMTNLNDYFSEETV
                    **********************.*************************************

    COL             EIMLSNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLA
    N315            EMMLSNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLA
    NCTC8325        EIMLSNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLA
    Newman          EIMLSNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLA
    USA300_FPR3757  EIMLSNIEVIVGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLA
                    *:**********************************************************

    COL             QQHHARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNN
    N315            QQHHARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNN
    NCTC8325        QQHHARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNN
    Newman          QQHHARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNN
    USA300_FPR3757  QQHHARLIYVSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNN
                    ************************************************************

    COL             GLDGRIVRVGNLTNPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTT
    N315            GLDGRIVRVGNLTSPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTT
    NCTC8325        GLDGRIVRVGNLTNPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTT
    Newman          GLDGRIVRVGNLTNPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTT
    USA300_FPR3757  GLDGRIVRVGNLTNPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTT
                    *************.**********************************************

    COL             ARQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
    N315            ARQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
    NCTC8325        ARQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
    Newman          ARQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
    USA300_FPR3757  ARQIVALAQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETI
                    ************************************************************

    COL             GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK
    N315            GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK
    NCTC8325        GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK
    Newman          GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK
    USA300_FPR3757  GLTSVDREQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK
                    ***************************************************