From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001019000
  • symbol?:
  • description?: 4'-phosphopantetheinyl transferase

      descriptions from strain specific annotations:

    • 4'-phosphopantetheinyl transferase
    • 4'-phosphopantetheinyl transferase superfamily protein
    • 4'-phosphopantetheinyl transferase family protein
    • 4'-phosphopantetheinyl transferase-like protein
    • holo-[acyl-carrier-protein] synthase
  • strand?: +
  • coordinates?: 1291630..1292274
  • synteny block?: BlockID0005470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0181
    08BA02176:
    C248_0169
    11819-97:
    MS7_0173
    71193:
    ST398NM01_0194
    ECT-R 2:
    ECTR2_143
    ED133:
    SAOV_0124
    ED98:
    SAAV_0148
    HO 5096 0412:
    SAEMRSA15_01450
    JH1:
    SaurJH1_0170
    JH9:
    SaurJH9_0165
    JKD6008:
    SAA6008_00158
    JKD6159:
    SAA6159_00161
    LGA251:
    SARLGA251_01510
    M013:
    M013TW_0167
    MRSA252:
    SAR0181
    MSHR1132:
    SAMSHR1132_01530
    MSSA476:
    SAS0155
    Mu3:
    SAHV_0179
    Mu50:
    SAV0180
    MW2:
    MW0154
    RF122:
    SAB0120
    ST398:
    SAPIG0194
    T0131:
    SAT0131_00171 (era)
    TCH60:
    HMPREF0772_10319 (acpS)
    TW20:
    SATW20_01900
    USA300_TCH1516:
    USA300HOU_0193
    VC40:
    SAVC_00665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRLGDILVQYGIQHDTGL
    N315            MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRLGDILVQYGIQHDTGL
    NCTC8325        MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRLGDILVQYGIQHDTGL
    Newman          MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRLGDILVQYGIQHDTGL
    USA300_FPR3757  MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRLGDILVQYGIQHDTGL
                    ************************************************************

    COL             LPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDKEPVGIDIEKISQRLDW
    N315            LPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDKEPVGIDIEKISQRLDW
    NCTC8325        LPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDKEPVGIDIEKISQRLDW
    Newman          LPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDKEPVGIDIEKISQRLDW
    USA300_FPR3757  LPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDKEPVGIDIEKISQRLDW
                    ************************************************************

    COL             RTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGLDIYDMTQSHFYQSREVK
    N315            RTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGLDIYDMTQSHFYQSREVK
    NCTC8325        RTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGLDIYDMTQSHFYQSREVK
    Newman          RTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGLDIYDMTQSHFYQSREVK
    USA300_FPR3757  RTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGLDIYDMTQSHFYQSREVK
                    ************************************************************

    COL             FKQFIFDQFMVQVCFLGQAPWGYKKVSVFQLLSS
    N315            FKQFIFDQFMVQVCFLGEAPWGYKKVSVFQLLSS
    NCTC8325        FKQFIFDQFMVQVCFLGQAPWGYKKVSVFQLLSS
    Newman          FKQFIFDQFMVQVCFLGQAPWGYKKVSVFQLLSS
    USA300_FPR3757  FKQFIFDQFMVQVCFLGQAPWGYKKVSVFQLLSS
                    *****************:****************