From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001020000
  • symbol?:
  • description?: integral membrane protein

      descriptions from strain specific annotations:

    • integral membrane protein
    • Membrane protein
    • membrane associated protein
  • strand?: -
  • coordinates?: 1292656..1293135
  • synteny block?: BlockID0005480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0182
    08BA02176:
    C248_0170
    11819-97:
    MS7_0174
    71193:
    ST398NM01_0195
    ECT-R 2:
    ECTR2_144
    ED133:
    SAOV_0125
    ED98:
    SAAV_0149
    HO 5096 0412:
    SAEMRSA15_01460
    JH1:
    SaurJH1_0171
    JH9:
    SaurJH9_0166
    JKD6008:
    SAA6008_00159
    JKD6159:
    SAA6159_00162
    LGA251:
    SARLGA251_01520
    M013:
    M013TW_0168
    MRSA252:
    SAR0182
    MSHR1132:
    SAMSHR1132_01540
    MSSA476:
    SAS0156
    Mu3:
    SAHV_0180
    Mu50:
    SAV0181
    MW2:
    MW0155
    RF122:
    SAB0121c
    ST398:
    SAPIG0195
    T0131:
    SAT0131_00172 (cadC)
    TCH60:
    HMPREF0772_10318
    TW20:
    SATW20_01910
    USA300_TCH1516:
    USA300HOU_0194
    VC40:
    SAVC_00670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQ
    N315            MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQ
    NCTC8325        -----MGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQ
    Newman          MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQ
    USA300_FPR3757  MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQELLQQLGFSSEFTHQ
                         *******************************************************

    COL             TYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMP
    N315            TYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAIGQGAVFGIAIWVLFHLIIMP
    NCTC8325        TYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMP
    Newman          TYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMP
    USA300_FPR3757  TYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGAVFGIAIWVLFHLIIMP
                    ***************************************:********************

    COL             IMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
    N315            IMHTVPAVWDQPYQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
    NCTC8325        IMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
    Newman          IMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
    USA300_FPR3757  IMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKLN
                    ************:*******************************