From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001021000
  • symbol?: argB
  • description?: acetylglutamate kinase

      descriptions from strain specific annotations:

    • acetylglutamate kinase
    • amino acid kinase
    • putative amino acid kinase
  • strand?: -
  • coordinates?: 1293428..1294199
  • synteny block?: BlockID0005490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0167 (argB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0183
    08BA02176:
    C248_0171
    11819-97:
    MS7_0175 (argB)
    71193:
    ST398NM01_0196
    ECT-R 2:
    ECTR2_145 (argB)
    ED133:
    SAOV_0126 (argB)
    ED98:
    SAAV_0150 (argB)
    HO 5096 0412:
    SAEMRSA15_01470
    JH1:
    SaurJH1_0172
    JH9:
    SaurJH9_0167
    JKD6008:
    SAA6008_00160 (argB)
    JKD6159:
    SAA6159_00163 (argB)
    LGA251:
    SARLGA251_01530
    M013:
    M013TW_0169
    MRSA252:
    SAR0183
    MSHR1132:
    SAMSHR1132_01550
    MSSA476:
    SAS0157
    Mu3:
    SAHV_0181
    Mu50:
    SAV0182
    MW2:
    MW0156
    RF122:
    SAB0122c
    ST398:
    SAPIG0196 (argB)
    T0131:
    SAT0131_00173
    TCH60:
    HMPREF0772_10317 (argB)
    TW20:
    SATW20_01920
    USA300_TCH1516:
    USA300HOU_0195 (argB)
    VC40:
    SAVC_00675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNG
    N315            MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNG
    NCTC8325        MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNG
    Newman          MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNG
    USA300_FPR3757  MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFINEALSNQQIEPHFVNG
                    ************************************************************

    COL             LRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGV
    N315            LRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGV
    NCTC8325        LRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGV
    Newman          LRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGV
    USA300_FPR3757  LRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQLFEITSFDQQYGYVGV
                    ************************************************************

    COL             PTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAG
    N315            PTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAG
    NCTC8325        PTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAG
    Newman          PTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAG
    USA300_FPR3757  PTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYFIASSLKAPIYVLSNIAG
                    ************************************************************

    COL             VLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIES
    N315            VLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIES
    NCTC8325        VLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIES
    Newman          VLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIES
    USA300_FPR3757  VLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIENGCPKVIIASGNKPNIIES
                    ************************************************************

    COL             IYNNDFVGTTILNS
    N315            IYNNDFVGTTILNS
    NCTC8325        IYNNDFVGTTILNS
    Newman          IYNNDFVGTTILNS
    USA300_FPR3757  IYNNDFVGTTILNS
                    **************