From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001030000
  • symbol?:
  • description?: indole-3-pyruvate decarboxylase

      descriptions from strain specific annotations:

    • indole-3-pyruvate decarboxylase
    • Pyruvate decarboxylase
    • Alpha-keto-acid decarboxylase
    • thiamine pyrophosphate enzyme, C-terminal TPP binding domain protein
    • thiamine pyrophosphate binding domain-containing protein
    • putative thiamine pyrophosphate enzyme
    • indolepyruvate decarboxylase
    • branched-chain alpha-ketoacid decarboxylase
    • indole-3-pyruvate decarboxylase (Indolepyruvatedecarboxylase)
    • thiamine pyrophosphate TPP binding domain-containing protein
    • Pyruvate decarboxylase, Alpha-keto-acid decarboxylase
  • strand?: -
  • coordinates?: 1302359..1303999
  • synteny block?: BlockID0005570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0173 (ipdC)
    N315:
    NCTC8325:
    Newman:
    NWMN_0132 (ipdC)
    USA300_FPR3757:
    04-02981:
    SA2981_0189
    08BA02176:
    C248_0179
    11819-97:
    MS7_0181 (kdcA)
    71193:
    ST398NM01_0205
    ECT-R 2:
    ECTR2_151
    ED133:
    SAOV_0132 (ipdC)
    ED98:
    SAAV_0156 (ipdC)
    HO 5096 0412:
    SAEMRSA15_01530
    JH1:
    SaurJH1_0178
    JH9:
    SaurJH9_0173
    JKD6008:
    SAA6008_00166 (ipdC)
    JKD6159:
    SAA6159_00169 (ipdC)
    LGA251:
    SARLGA251_01590
    M013:
    M013TW_0175
    MRSA252:
    SAR0189
    MSHR1132:
    SAMSHR1132_01630
    MSSA476:
    SAS0163
    Mu3:
    SAHV_0187
    Mu50:
    SAV0188
    MW2:
    MW0162
    RF122:
    SAB0128c
    ST398:
    SAPIG0205
    T0131:
    SAT0131_00180
    TCH60:
    HMPREF0772_10311 (ipdC)
    TW20:
    SATW20_01980
    USA300_TCH1516:
    USA300HOU_0201
    VC40:
    SAVC_00705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGY
    N315            MKQRIGAYLIDAFHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGY
    NCTC8325        MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGY
    Newman          MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGY
    USA300_FPR3757  MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGY
                    ************:***********************************************

    COL             ARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEQGGKYVHHSLGEGT
    N315            ARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEQAGKYVHHSLGEGT
    NCTC8325        ARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEQGGKYVHHSLGEGT
    Newman          ARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEQGGKYVHHSLGEGT
    USA300_FPR3757  ARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEQGGKYVHHSLGEGT
                    ***********************************************.************

    COL             FDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPF
    N315            FDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPF
    NCTC8325        FDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPF
    Newman          FDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPF
    USA300_FPR3757  FDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPF
                    ************************************************************

    COL             EVTATKYTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQELEDFVNQTQIPVAQLSL
    N315            EVTATKDTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQELEDFVNQTQIPVAQLSL
    NCTC8325        EVTATKYTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQELEDFVNQTQIPVAQLSL
    Newman          EVTATKYTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQELEDFVNQTQIPVAQLSL
    USA300_FPR3757  EVTATKYTDASTYIELLATKLHQAKQPIIITGHEINSFHLHQELEDFVNQTQIPVAQLSL
                    ****** *****************************************************

    COL             GKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAKLTDSATAGFSYQFNIDDVV
    N315            GKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAKLTDSATAGFSYQFNIDDVV
    NCTC8325        GKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAKLTDSATAGFSYQFNIDDVV
    Newman          GKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAKLTDSATAGFSYQFNIDDVV
    USA300_FPR3757  GKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAKLTDSATAGFSYQFNIDDVV
                    ************************************************************

    COL             MLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNNATFPAYHRPTSPDYTVGTEPLTQQTY
    N315            MLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNSATFPAYHRPTSPDYTVGTEPLTQQTY
    NCTC8325        MLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNNATFPAYHRPTSPDYTVGTEPLTQQTY
    Newman          MLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNNATFPAYHRPTSPDYTVGTEPLTQQTY
    USA300_FPR3757  MLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNNATFPAYHRPTSPDYTVGTEPLTQQTY
                    *********************************.**************************

    COL             FKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK
    N315            FKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK
    NCTC8325        FKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK
    Newman          FKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK
    USA300_FPR3757  FKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK
                    ************************************************************

    COL             DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWD
    N315            DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWD
    NCTC8325        DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWD
    Newman          DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWD
    USA300_FPR3757  DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWD
                    ************************************************************

    COL             YKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMAVEDAPKKLIDIAKA
    N315            YKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMSVEDAPKKLIDIAKA
    NCTC8325        YKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMAVEDAPKKLIDIAKA
    Newman          YKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMAVEDAPKKLIDIAKA
    USA300_FPR3757  YKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMAVEDAPKKLIDIAKA
                    *********************************************:**************

    COL             FSQQNK
    N315            FSQQNK
    NCTC8325        FSQQNK
    Newman          FSQQNK
    USA300_FPR3757  FSQQNK
                    ******