From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001032000
  • symbol?: glcA
  • description?: PTS glucose EIICBA component

      descriptions from strain specific annotations:

    • PTS glucose EIICBA component
    • PTS system, IIABC components
    • PTS system glucose-specific protein
    • glucose-specific PTS transporter protein IIABC component
    • PTS system glucose-specific IIBC subunit
    • glucose-specific PTS transporter protein, IIABC component
    • phosphotransferase system enzyme II glucose-specific factor IIA
    • PTS enzyme II
    • PTS family glucose/glucoside (glc) porter component IIABC
    • PTS family glucose porter, IICBA component
    • PTS family porter enzyme II glucose-specific factor IIA
    • pts system, glucose-specific iibc component
    • PTS system, glucose-specific IICBA component
    • PTS system, glucose-specific IIC component / PTS system, glucose-specific IIB component / PTS system, glucose-specific IIA component
    • PTS system glucose-like transporter subunit IIB
    • PTS system glucose-specific transporter subunit IIABC
    • PTS system glucose-specific transporter subunit IIBC
    • PTS system glucose-specific transporter subunit IICBA
    • PTS system transporter subunit IIABC
  • strand?: -
  • coordinates?: 1304299..1306296
  • synteny block?: BlockID0005590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0183 (glcA)
    NCTC8325:
    Newman:
    NWMN_0133 (glcA)
    USA300_FPR3757:
    04-02981:
    SA2981_0190 (glcA)
    08BA02176:
    C248_0181 (glcA)
    11819-97:
    MS7_0182 (ptsG)
    71193:
    ST398NM01_0207
    ECT-R 2:
    ECTR2_152 (ptsG)
    ED133:
    SAOV_0134
    ED98:
    SAAV_0158
    HO 5096 0412:
    SAEMRSA15_01540 (glcA)
    JH1:
    SaurJH1_0179
    JH9:
    SaurJH9_0174
    JKD6008:
    SAA6008_00168
    JKD6159:
    SAA6159_00171
    LGA251:
    SARLGA251_01600 (glcA)
    M013:
    M013TW_0177
    MRSA252:
    SAR0190 (glcA)
    MSHR1132:
    SAMSHR1132_01640
    MSSA476:
    SAS0164
    Mu3:
    SAHV_0188 (glcA)
    Mu50:
    SAV0189 (glcA)
    MW2:
    MW0163 (glcA)
    RF122:
    SAB0129c (glcA)
    ST398:
    SAPIG0207 (ptsG)
    T0131:
    SAT0131_00182
    TCH60:
    HMPREF0772_10309 (ptsG2)
    TW20:
    SATW20_01990 (glcA)
    USA300_TCH1516:
    USA300HOU_0203
    VC40:
    SAVC_00715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLM
    N315            MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAIQGEALQHYLPFIQNGGVQNVAKLM
    NCTC8325        ----------------MLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLM
    Newman          MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLM
    USA300_FPR3757  MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYLPFIQNGGVQTVAKLM
                                    *******************:***:**************.*****

    COL             TGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTMGDFLQVTPKNIGDPA
    N315            TAAGSIIFENLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTMGDFLQVTPKNVTDPA
    NCTC8325        TGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTMGDFLQVTPKNIGDPA
    Newman          TGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTMGDFLQVTPKNIGDPA
    USA300_FPR3757  TGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKTMGDFLQVTPKNIGDPA
                    *.**.***:**********************************************: ***

    COL             SGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSF
    N315            SGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSF
    NCTC8325        SGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSF
    Newman          SGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSF
    USA300_FPR3757  SGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLGFFAGKRFVPIMMATTSF
                    ************************************************************

    COL             ILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWFEF
    N315            ILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWFEF
    NCTC8325        ILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWFEF
    Newman          ILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWFEF
    USA300_FPR3757  ILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRLLIPFGLHHIFHAPFWFEF
                    ************************************************************

    COL             GSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVMMFGLPAAALAIYHTAKPEN
    N315            GSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVMMFGLPAAALAIYHTAKPEN
    NCTC8325        GSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVMMFGLPAAALAIYHTAKPEN
    Newman          GSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVMMFGLPAAALAIYHTAKPEN
    USA300_FPR3757  GSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVMMFGLPAAALAIYHTAKPEN
                    ************************************************************

    COL             KKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLTLYLLDLHLGYT
    N315            KKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLTLYLLDVHLGYT
    NCTC8325        KKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLTLYLLDLHLGYT
    Newman          KKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLTLYLLDLHLGYT
    USA300_FPR3757  KKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHAVLDGLSFLTLYLLDLHLGYT
                    ******************************************************:*****

    COL             FSGGFIDYFLLGILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGREDKQSQAA
    N315            FSGGFIDYVLLGVLPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGREDKQSQAV
    NCTC8325        FSGGFIDYFLLGILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGREDKQSQAA
    Newman          FSGGFIDYFLLGILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGREDKQSQAA
    USA300_FPR3757  FSGGFIDYFLLGILPNKTQWWLVIPVGLVYAVIYYFVFRFLIVKLKYKTPGREDKQSQAA
                    ********.***:**********************************************.

    COL             TASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVGNN
    N315            TASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVGNN
    NCTC8325        TASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVGNN
    Newman          TASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVGNN
    USA300_FPR3757  TASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDKSKVDVPGLKDLGASGVLEVGNN
                    ************************************************************

    COL             MQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLT
    N315            MQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLT
    NCTC8325        MQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLT
    Newman          MQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLT
    USA300_FPR3757  MQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDETVVVAEDKSATSELSHIVHAPLT
                    ************************************************************

    COL             GEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLEL
    N315            GEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKIQMIFPTKHAIGLVSDSGLEL
    NCTC8325        GEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLEL
    Newman          GEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLEL
    USA300_FPR3757  GEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPFNGKVQMIFPTKHAIGLVSDSGLEL
                    ***************************************:********************

    COL             LIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITN
    N315            LIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITN
    NCTC8325        LIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITN
    Newman          LIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITN
    USA300_FPR3757  LIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINFDLDYIRNHAKSDITPIIVTQGNITN
                    ************************************************************

    COL             LDFKQGEHGNISFGDQLFEAK
    N315            LDFKQGEHGNISFGDQLFEAK
    NCTC8325        LDFKQGEHGNISFGDQLFEAK
    Newman          LDFKQGEHGNISFGDQLFEAK
    USA300_FPR3757  LDFKQGEHGNISFGDQLFEAK
                    *********************