From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001036000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • RpiR family phosphosugar-binding transcriptional regulator
    • RpiR family transcriptional regulator
    • phosphosugar-binding transcriptional regulator, RpiR family
    • transcription regulator RpiR family
    • Sialic acid utilization regulator, RpiR family
    • RpiR family transcription regulator
    • RpiR family transcripitonal regulator
    • Transcriptional regulator, RpiR family
    • helix-turn-helix domain, rpiR family protein
  • strand?: +
  • coordinates?: 1311372..1312250
  • synteny block?: BlockID0005630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0194
    08BA02176:
    C248_0185
    11819-97:
    MS7_0186
    71193:
    ST398NM01_0211
    ECT-R 2:
    ECTR2_156
    ED133:
    SAOV_0138
    ED98:
    SAAV_0162
    HO 5096 0412:
    SAEMRSA15_01580
    JH1:
    SaurJH1_0183
    JH9:
    SaurJH9_0178
    JKD6008:
    SAA6008_00172
    JKD6159:
    SAA6159_00175
    LGA251:
    SARLGA251_01640
    M013:
    M013TW_0181
    MRSA252:
    SAR0194
    MSHR1132:
    SAMSHR1132_01680
    MSSA476:
    SAS0168
    Mu3:
    SAHV_0192
    Mu50:
    SAV0193
    MW2:
    MW0167
    RF122:
    SAB0133
    ST398:
    SAPIG0211
    T0131:
    SAT0131_00188
    TCH60:
    HMPREF0772_10305
    TW20:
    SATW20_02030
    USA300_TCH1516:
    USA300HOU_0207
    VC40:
    SAVC_00735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
    N315            -MTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
    NCTC8325        -MTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
    Newman          MMTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
    USA300_FPR3757  -MTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADVTNVSTASIVRFSRKM
                     ***********************************************************

    COL             THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
    N315            THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
    NCTC8325        THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
    Newman          THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
    USA300_FPR3757  THQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIARATNTMRFVATNIMDAQ
                    ************************************************************

    COL             IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
    N315            IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
    NCTC8325        IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
    Newman          IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
    USA300_FPR3757  IDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLLHETHLLVSTFATHDDRD
                    ************************************************************

    COL             CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
    N315            CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
    NCTC8325        CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
    Newman          CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
    USA300_FPR3757  CMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQIADYALIYGRTDENEMRMA
                    ************************************************************

    COL             ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
    N315            ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
    NCTC8325        ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
    Newman          ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
    USA300_FPR3757  ATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNYRKHLATIDFKH
                    ****************************************************