From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001056000
  • symbol?:
  • description?: oligopeptide transport ATP-binding protein

      descriptions from strain specific annotations:

    • oligopeptide transport ATP-binding protein
    • ABC transporter
    • peptide ABC transporter ATP-binding protein
    • Putative glutathione transporter, ATP-binding component
    • glutathione import ATP-binding protein gsiA
    • oligopeptide ABC transporter ATP-binding protein
    • nickel import ATP-binding protein NikE
    • oligopeptide ABC superfamily ATP binding cassette transporter, ABC protein
    • pseudogene
  • strand?: -
  • coordinates?: 1329983..1331575
  • synteny block?: BlockID0005780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0198 (oppF)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0206 (oppF)
    08BA02176:
    C248_0190
    11819-97:
    MS7_0191 (nikE)
    71193:
    ST398NM01_0215
    ECT-R 2:
    ECTR2_166
    ED133:
    SAOV_0144
    ED98:
    SAAV_0171
    HO 5096 0412:
    SAEMRSA15_01640
    JH1:
    SaurJH1_0196
    JH9:
    SaurJH9_0190
    JKD6008:
    SAA6008_00175
    JKD6159:
    SAA6159_00180
    LGA251:
    SARLGA251_01700
    M013:
    M013TW_0185
    MRSA252:
    SAR0198
    MSHR1132:
    SAMSHR1132_01710
    MSSA476:
    SAS0181
    Mu3:
    SAHV_0204 (oppF)
    Mu50:
    SAV0205 (oppF)
    MW2:
    MW0181 (oppF)
    RF122:
    SAB0144c
    ST398:
    SAPIG0215
    T0131:
    SAT0131_00191
    TCH60:
    HMPREF0772_10301 (oppF)
    TW20:
    SATW20_02070
    USA300_TCH1516:
    USA300HOU_0212
    VC40:
    SAVC_00765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGSGKSITAKSILGLLPD
    N315            MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGSGKSITAKSILGLLPD
    NCTC8325        MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGSGKSITAKSILGLLPD
    Newman          MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGSGKSITAKSILGLLPD
    USA300_FPR3757  MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGSGKSITAKSILGLLPD
                    ************************************************************

    COL             YPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSLNPRLTIGKQITEVIFQ
    N315            YPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSLNPRLTIGKQITEVLFQ
    NCTC8325        YPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSLNPRLTIGKQITEVIFQ
    Newman          YPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSLNPRLTIGKQITEVIFQ
    USA300_FPR3757  YPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSLNPRLTIGKQITEVIFQ
                    *********************************************************:**

    COL             HKRVSKSEAKSMTIDILEKVGIKHATRQFDAYPHELSGGMRQRVMIAMALILKPQILIAD
    N315            HKRVSKSEAKSMTINILEKVGIKHATRQFDAYPHELSGGMRQRVMIAMALILKPQILIAD
    NCTC8325        HKRVSKSEAKSMTIDILEKVGIKHATRQFDAYPHELSGGMRQRVMIAMALILKPQILIAD
    Newman          HKRVSKSEAKSMTIDILEKVGIKHATRQFDAYPHELSGGMRQRVMIAMALILKPQILIAD
    USA300_FPR3757  HKRVSKSEAKSMTIDILEKVGIKHATRQFDAYPHELSGGMRQRVMIAMALILKPQILIAD
                    **************:*********************************************

    COL             EPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQFCDDVIVMKDGSVVESGTV
    N315            EPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQFCDDVIVMKDGSVVESGTV
    NCTC8325        EPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQFCDDVIVMKDGSVVESGTV
    Newman          EPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQFCDDVIVMKDGSVVESGTV
    USA300_FPR3757  EPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQFCDDVIVMKDGSVVESGTV
                    ************************************************************

    COL             ESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDRVSVDYTSPSGSLYRAVNDI
    N315            ESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDRVSVDYTSPSGSLYRAVNDI
    NCTC8325        ESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDRVSVDYTSPSGSLYRAVNDI
    Newman          ESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDRVSVDYTSPSGSLYRAVNDI
    USA300_FPR3757  ESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDRVSVDYTSPSGSLYRAVNDI
                    ************************************************************

    COL             NLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWYNELPLSLFKDDELKSLRQEI
    N315            NLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWYNELPLSLFKDDELKSLRQEI
    NCTC8325        NLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWYNELPLSLFKDDELKSLRQEI
    Newman          NLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWYNELPLSLFKDDELKSLRQEI
    USA300_FPR3757  NLAIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWYNELPLSLFKDDELKSLRQEI
                    ************************************************************

    COL             QMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIKTVVSLLEKVGLDQTFLYRYPH
    N315            QMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIKTVVSLLEKVGLDQSFLYRYPH
    NCTC8325        QMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIKTVVSLLEKVGLDQTFLYRYPH
    Newman          QMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIKTVVSLLEKVGLDQTFLYRYPH
    USA300_FPR3757  QMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIKTVVSLLEKVGLDQTFLYRYPH
                    ****************************************************:*******

    COL             ELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQKDIIELLKQLQLDFGITYLFITH
    N315            ELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQKDIIELLKQLQLDFGITYLFITH
    NCTC8325        ELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQKDIIELLKQLQLDFGITYLFITH
    Newman          ELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQKDIIELLKQLQLDFGITYLFITH
    USA300_FPR3757  ELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQKDIIELLKQLQLDFGITYLFITH
                    ************************************************************

    COL             DMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDYAKQLISEVAVIAK
    N315            DMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDYAKQLISEVAVIAK
    NCTC8325        DMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDYAKQLISEVAVIAK
    Newman          DMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDYAKQLISEVAVIAK
    USA300_FPR3757  DMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDYAKQLISEVAVIAK
                    **************************************************