From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001057000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • peptide ABC transporter permease
    • oligopeptide ABC transporter permease
    • putative glutathione transporter, permease compo nent
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • Nickel ABC transporter, permease subunit NikB
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • oligopeptide ABC transporter membrane protein
    • oligopeptide ABC transporter permease protein
    • Oligopeptide transport system permease protein
    • putative transport system permease
  • strand?: +
  • coordinates?: 1331532..1333010
  • synteny block?: BlockID0005790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0199 (oppB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0207 (oppB)
    08BA02176:
    C248_0189
    11819-97:
    MS7_0192
    71193:
    ST398NM01_0216
    ECT-R 2:
    ECTR2_167
    ED133:
    SAOV_0145
    ED98:
    SAAV_0172
    HO 5096 0412:
    SAEMRSA15_01650
    JH1:
    SaurJH1_0197
    JH9:
    SaurJH9_0191
    JKD6008:
    SAA6008_00176
    JKD6159:
    SAA6159_00181
    LGA251:
    SARLGA251_01710
    M013:
    M013TW_0186
    MRSA252:
    SAR0199
    MSHR1132:
    SAMSHR1132_01720
    MSSA476:
    SAS0182
    Mu3:
    SAHV_0205
    Mu50:
    SAV0206 (truncated-oppB)
    MW2:
    MW0182 (oppB)
    RF122:
    SAB0145
    ST398:
    SAPIG0216
    T0131:
    SAT0131_00192
    TCH60:
    HMPREF0772_10300
    TW20:
    SATW20_02080
    USA300_TCH1516:
    USA300HOU_0213
    VC40:
    SAVC_00770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------------------------------------MYH
    N315            -----------------------------------------------MITYLESFKSLYH
    NCTC8325        MNCTFRLLTSNKFDMMLCLPIHKCVNLFYTFVYHSNLLKIILQGVIIIITYLESFKSLYH
    Newman          MNCTFRLLTSNKFDMMLCLPIHKCVNLFYTFVYHSNLLKIILQGVIIIITYLESFKSLYH
    USA300_FPR3757  MNCTFRLLTSNKFDMMLCLPIHKCVNLFYTFVYHSNLLKIILQGVIIIITYLESFKSLYH
                                                                             :**

    COL             KAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEIEQALHQKYKYLSQQKSST
    N315            KAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEIERALHQKYKYLSQQKSST
    NCTC8325        KAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEIEQALHQKYKYLSQQKSST
    Newman          KAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEIEQALHQKYKYLSQQKSST
    USA300_FPR3757  KAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEIEQALHQKYKYLSQQKSST
                    *******************************************:****************

    COL             QIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENVLFHKFIMIKVILALPMFILLTFYLQP
    N315            QIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENLLFHKFIMIKVILALPMFILLTIYLQP
    NCTC8325        QIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENVLFHKFIMIKVILALPMFILLTFYLQP
    Newman          QIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENVLFHKFIMIKVILALPMFILLTFYLQP
    USA300_FPR3757  QIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENVLFHKFIMIKVILALPMFILLTFYLQP
                    *********************************:*********************:****

    COL             LVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILGQNATKAQIHQFNVLHHLNEP
    N315            LVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILGQNATKAQIHQFNVLHHLNEP
    NCTC8325        LVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILGQNATKAQIHQFNVLHHLNEP
    Newman          LVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILGQNATKAQIHQFNVLHHLNEP
    USA300_FPR3757  LVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILGQNATKAQIHQFNVLHHLNEP
                    ************************************************************

    COL             YFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITIIVAVLALMVALIIAIPIGIIS
    N315            YFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITIIVAVLALIVALIIAIPIGIIS
    NCTC8325        YFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITIIVAVLALMVALIIAIPIGIIS
    Newman          YFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITIIVAVLALMVALIIAIPIGIIS
    USA300_FPR3757  YFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITIIVAVLALMVALIIAIPIGIIS
                    **********************************************:*************

    COL             AMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLKLDILPPSYMPEHPISLILPVLV
    N315            AMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLKLDILPPSYMPEHPISLILPVLV
    NCTC8325        AMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLKLDILPPSYMPEHPISLILPVLV
    Newman          AMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLKLDILPPSYMPEHPISLILPVLV
    USA300_FPR3757  AMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLKLDILPPSYMPEHPISLILPVLV
                    ************************************************************

    COL             IGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTTQVVIKHILKNAIIPIVTLVGLLV
    N315            IGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTTQVVIKHILKNAIIPIVTLVGLLV
    NCTC8325        IGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTTQVVIKHILKNAIIPIVTLVGLLV
    Newman          IGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTTQVVIKHILKNAIIPIVTLVGLLV
    USA300_FPR3757  IGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTTQVVIKHILKNAIIPIVTLVGLLV
                    ************************************************************

    COL             AELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVMGGVVYISIVISLANLIIDIFYALI
    N315            AELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVMGGVVYISIVISLANLIIDIFYALI
    NCTC8325        AELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVMGGVVYISIVISLANLIIDIFYALI
    Newman          AELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVMGGVVYISIVISLANLIIDIFYALI
    USA300_FPR3757  AELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVMGGVVYISIVISLANLIIDIFYALI
                    ************************************************************

    COL             DPKLRSEINERK
    N315            DPKLRSEINERK
    NCTC8325        DPKLRSEINERK
    Newman          DPKLRSEINERK
    USA300_FPR3757  DPKLRSEINERK
                    ************