From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001066000
  • symbol?: malF
  • description?: maltose ABC transporter permease

      descriptions from strain specific annotations:

    • maltose ABC transporter permease
    • sugar ABC transporter permease
    • binding-protein-dependent transport system inner membrane protein
    • MalC
    • maltose/maltodextrin ABC superfamily ATP binding cassette transporter, membrane protein
    • Maltose/maltodextrin ABC transporter, permease protein MalF
    • maltose/maltodextrin ABC transporter membrane protein
    • Maltose/maltodextrin ABC transporter permease MalF
    • Maltose/maltodextrin transport permease
    • maltose/maltodextrin transport permease homologue
    • maltose/maltodextrin transport permease-like protein
    • maltose/maltodextrin transport permease protein
    • maltose ABC transporter, permease protein
    • maltose transport system permease protein malF
    • putative sugar transport system permease
    • sugar transport system permease
    • TM2 domain-containing protein
  • strand?: +
  • coordinates?: 1343507..1344775
  • synteny block?: BlockID0005880
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0216
    08BA02176:
    C248_0199
    11819-97:
    MS7_0201
    71193:
    ST398NM01_0225
    ECT-R 2:
    ECTR2_176
    ED133:
    SAOV_0153
    ED98:
    SAAV_0181
    HO 5096 0412:
    SAEMRSA15_01740
    JH1:
    SaurJH1_0206
    JH9:
    SaurJH9_0200
    JKD6008:
    SAA6008_00184
    JKD6159:
    SAA6159_00190
    LGA251:
    SARLGA251_01790
    M013:
    M013TW_0195
    MRSA252:
    SAR0207
    MSHR1132:
    SAMSHR1132_01810
    MSSA476:
    SAS0191
    Mu3:
    SAHV_0214
    Mu50:
    SAV0215
    MW2:
    MW0191
    RF122:
    SAB0153
    ST398:
    SAPIG0225
    T0131:
    SAT0131_00200 (hrcA)
    TCH60:
    HMPREF0772_10292 (malC)
    TW20:
    SATW20_02160
    USA300_TCH1516:
    USA300HOU_0222
    VC40:
    SAVC_00815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYSFLNIGFWGLFTLGTV
    N315            MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYSFLNIGFWGLFTLGTV
    NCTC8325        MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYSFLNIGFWGLFTLGTV
    Newman          MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYSFLNIGFWGLFTLGTV
    USA300_FPR3757  MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYSFLNIGFWGLFTLGTV
                    ************************************************************

    COL             PKLDDSRVLLAQGIISILLVAFAIMLYIINILDAYRNAERFNRNEEIKDPKARMVATWDK
    N315            PKLDDSRVLLAQGIISILLVAFAIMLYVINILDAYRNAERFNRNEEIKDPKARMVATWDK
    NCTC8325        PKLDDSRVLLAQGIISILLVAFAIMLYIINILDAYRNAERFNRNEEIKDPKARMVATWDK
    Newman          PKLDDSRVLLAQGIISILLVAFAIMLYIINILDAYRNAERFNRNEEIKDPKARMVATWDK
    USA300_FPR3757  PKLDDSRVLLAQGIISILLVAFAIMLYIINILDAYRNAERFNRNEEIKDPKARMVATWDK
                    ***************************:********************************

    COL             TFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHTLEWVGLDNFKTLFTIGV
    N315            TFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHTLEWVGLDNFKTLFTIGV
    NCTC8325        TFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHTLEWVGLDNFKTLFTIGV
    Newman          TFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHTLEWVGLDNFKTLFTIGV
    USA300_FPR3757  TFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHTLEWVGLDNFKTLFTIGV
                    ************************************************************

    COL             WRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGKKFIRTVLILPWAVPSFVT
    N315            WRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGKKFIRTVLILPWAVPSFVT
    NCTC8325        WRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGKKFIRTVLILPWAVPSFVT
    Newman          WRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGKKFIRTVLILPWAVPSFVT
    USA300_FPR3757  WRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGKKFIRTVLILPWAVPSFVT
                    ************************************************************

    COL             ILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVALIGIQVWLGFPFVFALFTGV
    N315            ILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVALIGIQVWLGFPFVFALFTGV
    NCTC8325        ILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVALIGIQVWLGFPFVFALFTGV
    Newman          ILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVALIGIQVWLGFPFVFALFTGV
    USA300_FPR3757  ILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVALIGIQVWLGFPFVFALFTGV
                    ************************************************************

    COL             LQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLIMQYAGNFNNFNLIYLFNKGG
    N315            LQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLIMQYAGNFNNFNLIYLFNKGG
    NCTC8325        LQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLIMQYAGNFNNFNLIYLFNKGG
    Newman          LQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLIMQYAGNFNNFNLIYLFNKGG
    USA300_FPR3757  LQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLIMQYAGNFNNFNLIYLFNKGG
                    ************************************************************

    COL             PPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIGFIVAIVAFIQFRRTSTFKDEG
    N315            PPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIGFIVAIVAFIQFRRTSTFKDEG
    NCTC8325        PPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIGFIVAIVAFIQFRRTSTFKDEG
    Newman          PPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIGFIVAIVAFIQFRRTSTFKDEG
    USA300_FPR3757  PPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIGFIVAIVAFIQFRRTSTFKDEG
                    ************************************************************

    COL             GL
    N315            GL
    NCTC8325        GL
    Newman          GL
    USA300_FPR3757  GL
                    **