From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001067000
  • symbol?:
  • description?: maltose ABC transporter permease

      descriptions from strain specific annotations:

    • maltose ABC transporter permease
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • maltose/maltodextrin ABC superfamily ATP binding cassette transporter, membrane protein
    • Maltose/maltodextrin ABC transporter, permease protein MalG
    • maltose/maltodextrin ABC transporter membrane protein
    • Maltose/maltodextrin ABC transporter permease MalG
    • maltose/maltodextrin transport permease homologue
    • maltose/maltodextrin transport permease-like protein
    • maltose/maltodextrin transport system protein
    • maltose ABC transporter, permease protein
    • putative sugar transport system permease
    • sugar ABC transporter permease
    • sugar transport system permease
  • strand?: +
  • coordinates?: 1344699..1345616
  • synteny block?: BlockID0005890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0217
    08BA02176:
    C248_0200
    11819-97:
    MS7_0202
    71193:
    ST398NM01_0226
    ECT-R 2:
    ECTR2_177
    ED133:
    SAOV_0154
    ED98:
    SAAV_0182
    HO 5096 0412:
    SAEMRSA15_01750
    JH1:
    SaurJH1_0207
    JH9:
    SaurJH9_0201
    JKD6008:
    SAA6008_00185
    JKD6159:
    SAA6159_00191
    LGA251:
    SARLGA251_01800
    M013:
    M013TW_0196
    MRSA252:
    SAR0208
    MSHR1132:
    SAMSHR1132_01820
    MSSA476:
    SAS0192
    Mu3:
    SAHV_0215
    Mu50:
    SAV0216
    MW2:
    MW0192
    RF122:
    SAB0154
    ST398:
    SAPIG0226
    T0131:
    SAT0131_00201 (hemN)
    TCH60:
    HMPREF0772_10291 (malD)
    TW20:
    SATW20_02170
    USA300_TCH1516:
    USA300HOU_0223
    VC40:
    SAVC_00820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------------MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGI
    N315            --------------------------MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGI
    NCTC8325        --------------------------MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGI
    Newman          MDLLLLLSHLFNSDVQVRLKMREVYKMTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGI
    USA300_FPR3757  --------------------------MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGI
                                              **********************************

    COL             SLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTA
    N315            SLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTA
    NCTC8325        SLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTA
    Newman          SLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTA
    USA300_FPR3757  SLNPGTNLYGAKMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTA
                    ************************************************************

    COL             YAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPM
    N315            YAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPM
    NCTC8325        YAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPM
    Newman          YAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPM
    USA300_FPR3757  YAFSRYRFVGRKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPM
                    ************************************************************

    COL             NAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFIL
    N315            NAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFIL
    NCTC8325        NAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFIL
    Newman          NAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFIL
    USA300_FPR3757  NAFLVKGYFDTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFIL
                    ************************************************************

    COL             PKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTT
    N315            PKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTT
    NCTC8325        PKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTT
    Newman          PKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTT
    USA300_FPR3757  PKILLRSPEKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTT
                    ************************************************************

    COL             GATKG
    N315            GATKG
    NCTC8325        GATKG
    Newman          GATKG
    USA300_FPR3757  GATKG
                    *****