From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001083000
  • symbol?: pflA
  • description?: pyruvate formate-lyase-activating enzyme

      descriptions from strain specific annotations:

    • pyruvate formate-lyase-activating enzyme
    • formate acetyltransferase activating enzyme
    • pyruvate formate-lyase 1 activating enzyme
    • putative pyruvate formate-lyase activating enzyme
    • [formate-C-acetyltransferase]-activating enzyme
  • strand?: +
  • coordinates?: 1359328..1360083
  • synteny block?: BlockID0006050
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0205 (pflA)
    N315:
    SA0219 (pflA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0227 (pflA)
    08BA02176:
    C248_0210
    11819-97:
    MS7_0212 (pflA)
    71193:
    ST398NM01_0236
    ECT-R 2:
    ECTR2_187 (pflA)
    ED133:
    SAOV_0164 (pflA)
    ED98:
    SAAV_0192 (pflA)
    HO 5096 0412:
    SAEMRSA15_01850
    JH1:
    SaurJH1_0217
    JH9:
    SaurJH9_0211
    JKD6008:
    SAA6008_00195 (pflA)
    JKD6159:
    SAA6159_00201 (pflA)
    LGA251:
    SARLGA251_01900
    M013:
    M013TW_0206
    MRSA252:
    SAR0218
    MSHR1132:
    SAMSHR1132_01920
    MSSA476:
    SAS0202
    Mu3:
    SAHV_0226 (pflA)
    Mu50:
    SAV0227 (pflA)
    MW2:
    MW0202 (pflA)
    RF122:
    SAB0165
    ST398:
    SAPIG0236 (pflA)
    T0131:
    SAT0131_00213
    TCH60:
    HMPREF0772_10279 (pflA)
    TW20:
    SATW20_02270
    USA300_TCH1516:
    USA300HOU_0234 (pflA)
    VC40:
    SAVC_00870

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
    N315            MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
    NCTC8325        MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
    Newman          MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
    USA300_FPR3757  MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKISEPSREVTVDEMVNEI
                    ************************************************************

    COL             LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
    N315            LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
    NCTC8325        LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
    Newman          LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
    USA300_FPR3757  LPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCLDTSAGCANDTKAFQRH
                    ************************************************************

    COL             FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
    N315            FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
    NCTC8325        FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
    Newman          FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
    USA300_FPR3757  FEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSDMKQPVWIRHVLVPGYSD
                    ************************************************************

    COL             DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
    N315            DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
    NCTC8325        DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
    Newman          DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
    USA300_FPR3757  DKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYELEDVEAPDDEAVKAAYRY
                    ************************************************************

    COL             VNFKGKIPVEL
    N315            VNFKGKIPVEL
    NCTC8325        VNFKGKIPVEL
    Newman          VNFKGKIPVEL
    USA300_FPR3757  VNFKGKIPVEL
                    ***********