From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001088000
  • symbol?: coa
  • description?: staphylocoagulase

      descriptions from strain specific annotations:

    • staphylocoagulase
    • staphylocoagulase precursor
    • coagulase family-protein
    • pseudogene
  • strand?: +
  • coordinates?: 1362944..1365779
  • synteny block?: BlockID0006100
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0222 (coa)
    NCTC8325:
    Newman:
    NWMN_0166 (coa)
    USA300_FPR3757:
    04-02981:
    SA2981_0230 (coa)
    08BA02176:
    C248_0214 (coa)
    11819-97:
    MS7_0216 (coa)
    71193:
    ST398NM01_0240
    ECT-R 2:
    ECTR2_190
    ED133:
    SAOV_0167 (coa)
    ED98:
    SAAV_0195
    HO 5096 0412:
    SAEMRSA15_01880
    JH1:
    SaurJH1_0220
    JH9:
    SaurJH9_0214
    JKD6008:
    SAA6008_00199
    JKD6159:
    SAA6159_00204 (coa)
    LGA251:
    SARLGA251_01940 (coa)
    M013:
    M013TW_0209
    MRSA252:
    SAR0222
    MSHR1132:
    MSSA476:
    SAS0206
    Mu3:
    SAHV_0229 (coa)
    Mu50:
    SAV0230 (coa)
    MW2:
    MW0206 (coa)
    RF122:
    SAB0169
    ST398:
    SAPIG0240
    T0131:
    SAT0131_00217
    TCH60:
    HMPREF0772_10275 (coa)
    TW20:
    SATW20_02310 (coa)
    USA300_TCH1516:
    USA300HOU_0238
    VC40:
    SAVC_00890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSALYYL
    N315            MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKIIDSL
    NCTC8325        MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSALYYL
    Newman          MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSALYYL
    USA300_FPR3757  MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSALYYL
                    ********************************* :*:**  **:*: :.. *  . :  *

    COL             EDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQWYANYKKE
    N315            EAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKWYKSSNK-
    NCTC8325        EDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQWYANYKKE
    Newman          EDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQWYANYKKE
    USA300_FPR3757  EDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQWYANYKKE
                    *  :  **.* :.*:*** *********: :** ******::* .:** **:** . :* 

    COL             NPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDKNSDLKTFNAAEE
    N315            ----NTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLKQFDKDGE
    NCTC8325        NPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDKNSDLKTFNAAEE
    Newman          NPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDKNSDLKTFNAAEE
    USA300_FPR3757  NPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDKNSDLKTFNAAEE
                        : :* .****** :*:*:***:: ::** *: :*::***:*:.** *** *:   *

    COL             DKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEM
    N315            DKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEM
    NCTC8325        DKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEM
    Newman          DKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEM
    USA300_FPR3757  DKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEM
                    *******************:**.*************************************

    COL             IDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDS
    N315            IDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVEETKKAVKEADES
    NCTC8325        IDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDS
    Newman          IDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDS
    USA300_FPR3757  IDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDS
                    ********************:*****:**.**:* :*:********************:*

    COL             WKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPLVKI
    N315            WKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPVAQPLVKI
    NCTC8325        WKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPLVKI
    Newman          WKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPLVKI
    USA300_FPR3757  WKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPLVKI
                    **:****** ** **************** ***.**************************

    COL             PQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYTNPPLTNPILEGL
    N315            PQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNRPSLSDNYTQPTTPNPILEGL
    NCTC8325        PQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYTNPPLTNPILEGL
    Newman          PQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYTNPPLTNPILEGL
    USA300_FPR3757  PQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYTNPPLTNPILEGL
                    ** ** ** *************:***************. ****:***:*. .*******

    COL             EGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRD
    N315            EGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRD
    NCTC8325        EGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRD
    Newman          EGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRD
    USA300_FPR3757  EGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRD
                    ******************** ***************************************

    COL             AGTGIREYNDGTFGYEARPRF---------------------------NKPSETNAYNVT
    N315            AGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVT
    NCTC8325        AGTGIREYNDGTFGYEARPRF---------------------------NKPSETNAYNVT
    Newman          AGTGIREYNDGTFGYEARPRF---------------------------NKPSETNAYNVT
    USA300_FPR3757  AGTGIREYNDGTFGYEARPRF---------------------------N-----------
                    *********************                           *           

    COL             THANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQ
    N315            THANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQ
    NCTC8325        THANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQ
    Newman          THANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQ
    USA300_FPR3757  ----------------KPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQ
                                    ***:**********************:*************.***

    COL             VSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPR
    N315            VSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGPR
    NCTC8325        VSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPR
    Newman          VSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPR
    USA300_FPR3757  VSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPR
                    ******** :***:********************* ****:*******************

    COL             VTK
    N315            VTK
    NCTC8325        VTK
    Newman          VTK
    USA300_FPR3757  VTK
                    ***