From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001095000
  • symbol?: fadE
  • description?: acyl-CoA synthetase

      descriptions from strain specific annotations:

    • acyl-CoA synthetase
    • AMP-dependent synthetase and ligase
    • long-chain-fatty-acid--CoA ligase, putative
    • Long-chain-fatty-acid--CoA ligase
    • AMP-binding protein
    • acyl-CoA synthetase FadE
    • acyl-CoA synthetase FadE-like protein
    • putative acyl-CoA synthetase
    • o-succinylbenzoate--CoA ligase
    • long-chain acyl-CoA synthetase
  • strand?: -
  • coordinates?: 1371994..1373508
  • synteny block?: BlockID0006170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0170 (fadE)
    USA300_FPR3757:
    04-02981:
    SA2981_0234
    08BA02176:
    C248_0218 (fadE)
    11819-97:
    MS7_0220
    71193:
    ST398NM01_0244
    ECT-R 2:
    ECTR2_194
    ED133:
    SAOV_0171
    ED98:
    SAAV_0199
    HO 5096 0412:
    SAEMRSA15_01920 (fadE)
    JH1:
    SaurJH1_0224
    JH9:
    SaurJH9_0218
    JKD6008:
    SAA6008_00203
    JKD6159:
    SAA6159_00208
    LGA251:
    SARLGA251_01980 (fadE)
    M013:
    M013TW_0213
    MRSA252:
    SAR0226 (fadE)
    MSHR1132:
    SAMSHR1132_01990
    MSSA476:
    SAS0210
    Mu3:
    SAHV_0233
    Mu50:
    SAV0234
    MW2:
    MW0210
    RF122:
    SAB0173c
    ST398:
    SAPIG0244
    T0131:
    SAT0131_00221
    TCH60:
    HMPREF0772_10271 (menE)
    TW20:
    SATW20_02350 (fadE)
    USA300_TCH1516:
    USA300HOU_0243
    VC40:
    SAVC_00910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
    N315            MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
    NCTC8325        MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
    Newman          MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
    USA300_FPR3757  MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLTSQGVKKGDVIGIFAP
                    ************************************************************

    COL             NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
    N315            NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
    NCTC8325        NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
    Newman          NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
    USA300_FPR3757  NDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLFYAEKHLSSLTDIDQNL
                    ************************************************************

    COL             LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
    N315            LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
    NCTC8325        LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
    Newman          LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
    USA300_FPR3757  LHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTGSPKGVMFSYESFVHNGA
                    ************************************************************

    COL             NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
    N315            NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
    NCTC8325        NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
    Newman          NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
    USA300_FPR3757  NLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLILQRYFNGEELNDMIAQYHP
                    ************************************************************

    COL             TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
    N315            TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
    NCTC8325        TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
    Newman          TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
    USA300_FPR3757  TFIIMIPTMYYSTLRASNFNPENFRAMDYIIQGGSQPLPSIQAAFKQYGINIINGYGLTE
                    ************************************************************

    COL             APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
    N315            APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
    NCTC8325        APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
    Newman          APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
    USA300_FPR3757  APLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPTGEIGELAIKAKNVTPGYWNK
                    ************************************************************

    COL             PAETAKAFHGRYLLTGDLAKMDNDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
    N315            PAETAKAFHGRYLLTGDLAKMDDDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
    NCTC8325        PAETAKAFHGRYLLTGDLAKMDNDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
    Newman          PAETAKAFHGRYLLTGDLAKMDNDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
    USA300_FPR3757  PAETAKAFHGRYLLTGDLAKMDNDGDIFIIDRKKELIITGGENVLPSEVENALAEHPLVD
                    **********************:*************************************

    COL             RCVVVGYDHPKYGESIAAAIILREDEPHYAEILNQHMRSRLAGYKVPRMYVPVTHMPLNS
    N315            RCVVVGYDHPKYGESIAAAIILREDEPHYAEILDQHMRSRLAGYKVPRMYVPVTHMPLNS
    NCTC8325        RCVVVGYDHPKYGESIAAAIILREDEPHYAEILNQHMRSRLAGYKVPRMYVPVTHMPLNS
    Newman          RCVVVGYDHPKYGESIAAAIILREDEPHYAEILNQHMRSRLAGYKVPRMYVPVTHMPLNS
    USA300_FPR3757  RCVVVGYDHPKYGESIAAAIILREDEPHYAEILNQHMRSRLAGYKVPRMYVPVTHMPLNS
                    *********************************:**************************

    COL             TQKPDKLAIRQMMNDKVSQTL
    N315            TQKPDKLAIRQMMNDKVSQTL
    NCTC8325        TQKPDKLAIRQMMNDKVSQTL
    Newman          TQKPDKLAIRQMMNDKVSQTL
    USA300_FPR3757  TQKPDKLAIRQMMNDKVSQTL
                    *********************