From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001096000
  • symbol?: fadX
  • description?: acetyl-CoA/acetoacetyl-CoA transferase

      descriptions from strain specific annotations:

    • acetyl-CoA/acetoacetyl-CoA transferase
    • coenzyme A transferase
    • coenzyme A transferase family protein
    • propionate CoA-transferase
    • putative acyl-CoA transferase FadX
    • 3-oxoacid CoA-transferase
    • putative acetyl-CoA/acetoacetyl-CoA transferase
    • putative acetyl-CoA transferase
    • acetyl-CoA:acetoacetyl-CoA transferase subunit alpha
  • strand?: -
  • coordinates?: 1373534..1375096
  • synteny block?: BlockID0006180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0235
    08BA02176:
    C248_0219
    11819-97:
    MS7_0221
    71193:
    ST398NM01_0245
    ECT-R 2:
    ECTR2_195
    ED133:
    SAOV_0172
    ED98:
    SAAV_0200
    HO 5096 0412:
    SAEMRSA15_01930 (fadX)
    JH1:
    SaurJH1_0225
    JH9:
    SaurJH9_0219
    JKD6008:
    SAA6008_00204 (fadX)
    JKD6159:
    SAA6159_00209 (fadX)
    LGA251:
    SARLGA251_01990 (fadX)
    M013:
    M013TW_0214
    MRSA252:
    SAR0227 (fadX)
    MSHR1132:
    SAMSHR1132_02000
    MSSA476:
    SAS0211
    Mu3:
    SAHV_0234
    Mu50:
    SAV0235
    MW2:
    MW0211
    RF122:
    SAB0174c
    ST398:
    SAPIG0245
    T0131:
    SAT0131_00222
    TCH60:
    HMPREF0772_10270 (pct)
    TW20:
    SATW20_02360 (fadX)
    USA300_TCH1516:
    USA300HOU_0244
    VC40:
    SAVC_00915

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MTCLKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYHTPNDLTFILA
    N315            -----MKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYHTPKDLTFILA
    NCTC8325        MEVTCLKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYHTPNDLTFILA
    Newman          MEVTCLKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYHTPNDLTFILA
    USA300_FPR3757  MEVTCLKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYHTPNDLTFILA
                         :**********************************************:*******

    COL             NDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFLPQGIIATHYRQ
    N315            NDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFLPQGIIATHYRQ
    NCTC8325        NDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFLPQGIIATHYRQ
    Newman          NDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFLPQGIIATHYRQ
    USA300_FPR3757  NDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFLPQGIIATHYRQ
                    ************************************************************

    COL             SNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLHYTFPSVDVALLR
    N315            SNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLHYTFPSVDVALLR
    NCTC8325        SNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLHYTFPSVDVALLR
    Newman          SNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLHYTFPSVDVALLR
    USA300_FPR3757  SNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLHYTFPSVDVALLR
                    ************************************************************

    COL             GTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQLKPNEVVIPGNLV
    N315            GTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQLKPNEVVIPGNLV
    NCTC8325        GTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQLKPNEVVIPGNLV
    Newman          GTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQLKPNEVVIPGNLV
    USA300_FPR3757  GTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDDYQLKPNEVVIPGNLV
                    ************************************************************

    COL             DYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLILRRAAQFLTYGDTI
    N315            DYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLILRRAAQFLTYGDTI
    NCTC8325        DYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLILRRAAQFLTYGDTI
    Newman          DYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLILRRAAQFLTYGDTI
    USA300_FPR3757  DYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLILRRAAQFLTYGDTI
                    ************************************************************

    COL             SIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMNYNADVRMPHDRAWDF
    N315            SIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMNYNADVRMPHDRAWDF
    NCTC8325        SIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMNYNADVRMPHDRAWDF
    Newman          SIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMNYNADVRMPHDRAWDF
    USA300_FPR3757  SIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMNYNADVRMPHDRAWDF
                    ************************************************************

    COL             IYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSVNKIIFSGTFVAGSHVS
    N315            IYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSVNKIIFSGTFVAGSHVS
    NCTC8325        IYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSVNKIIFSGTFVAGSHVS
    Newman          IYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSVNKIIFSGTFVAGSHVS
    USA300_FPR3757  IYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSVNKIIFSGTFVAGSHVS
                    ************************************************************

    COL             CHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQSLEQEIYFVTDRAVFELTNQGLKLIEIA
    N315            CHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQLLEQEVYFVTDRAVFELTNQGLKLIEIA
    NCTC8325        CHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQSLEQEIYFVTDRAVFELTNQGLKLIEIA
    Newman          CHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQSLEQEIYFVTDRAVFELTNQGLKLIEIA
    USA300_FPR3757  CHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQSLEQEIYFVTDRAVFELTNQGLKLIEIA
                    ******************************** ****:**********************

    COL             PGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSIHKV
    N315            PGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSIHKV
    NCTC8325        PGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSIHKV
    Newman          PGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSIHKV
    USA300_FPR3757  PGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSIHKV
                    *********************************************