From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001098000
  • symbol?: prsS
  • description?: PrsW family intramembrane metalloprotease

      descriptions from strain specific annotations:

    • PrsW family intramembrane metalloprotease
    • membrane spanning protein
  • strand?: +
  • coordinates?: 1376314..1377591
  • synteny block?: BlockID0006200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0236
    08BA02176:
    C248_0221
    11819-97:
    MS7_0222
    71193:
    ST398NM01_0247
    ECT-R 2:
    ECTR2_196
    ED133:
    SAOV_0173
    ED98:
    SAAV_0201
    HO 5096 0412:
    SAEMRSA15_01950
    JH1:
    SaurJH1_0226
    JH9:
    SaurJH9_0220
    JKD6008:
    SAA6008_00206
    JKD6159:
    SAA6159_00210
    LGA251:
    SARLGA251_02000
    M013:
    M013TW_0215
    MRSA252:
    SAR0229
    MSHR1132:
    SAMSHR1132_02020
    MSSA476:
    SAS0212
    Mu3:
    SAHV_0235
    Mu50:
    SAV0236
    MW2:
    MW0212
    RF122:
    SAB0175
    ST398:
    SAPIG0247
    T0131:
    SAT0131_00225
    TCH60:
    HMPREF0772_10268
    TW20:
    SATW20_02380
    USA300_TCH1516:
    USA300HOU_0245
    VC40:
    SAVC_00920

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------------------------MSSASTQSTKTSDIHNESIDKQMEA
    N315            -----------------------------------MSSASTQSTKTSDIHNESINKQMEA
    NCTC8325        -----------------------------------MSSASTQSTKTSDIHNESIDKQMEA
    Newman          MKVGKSMEGLNHRRNTEKEETTQTQSVAPNTGEEGMSSASTQSTKTSDIHNESIDKQMEA
    USA300_FPR3757  -----------------------------------MSSASTQSTKTSDIHNESIDKQMEA
                                                       *******************:*****

    COL             KAHETAQNTDLKNEARSLFDNATKSIGRLAGNDESLNLNLKDMLSEVFKPHTKNEADEIF
    N315            KAHETAQNADLKTEARSLFDNATKSIGRLAGNDESLNLNLKDMFSEVFKPHTKNEADEIF
    NCTC8325        KAHETAQNTDLKNEARSLFDNATKSIGRLAGNDESLNLNLKDMLSEVFKPHTKNEADEIF
    Newman          KAHETAQNTDLKNEARSLFDNATKSIGRLAGNDESLNLNLKDMLSEVFKPHTKNEADEIF
    USA300_FPR3757  KAHETAQNTDLKNEARSLFDNATKSIGRLAGNDESLNLNLKDMLSEVFKPHTKNEADEIF
                    ********:***.******************************:****************

    COL             IAGTAKTTPAICDISEEWGKPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGAL
    N315            IAGTAKTTPAICDISEEWGKPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGAL
    NCTC8325        IAGTAKTTPAICDISEEWGKPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGAL
    Newman          IAGTAKTTPAICDISEEWGKPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGAL
    USA300_FPR3757  IAGTAKTTPAICDISEEWGKPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGAL
                    ************************************************************

    COL             TVPLSGLFFFYESNAFKNISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTF
    N315            TVPLSGLFFFYESNAFKNISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTF
    NCTC8325        TVPLSGLFFFYESNAFKNISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTF
    Newman          TVPLSGLFFFYESNAFKNISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTF
    USA300_FPR3757  TVPLSGLFFFYESNAFKNISIFEVIIMFFIGGVFSLLSTMVLYRFVVFSDQFERFGSLTF
                    ************************************************************

    COL             FDAFLVGLVEETGKALIIVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGE
    N315            FDAFLVGLVEETGKALIIVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGE
    NCTC8325        FDAFLVGLVEETGKALIIVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGE
    Newman          FDAFLVGLVEETGKALIIVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGE
    USA300_FPR3757  FDAFLVGLVEETGKALIIVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGE
                    ************************************************************

    COL             NVPLLDIVFTRAWTAIGGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVVLH
    N315            NVPLLDIVFTRAWTAIGGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVGLH
    NCTC8325        NVPLLDIVFTRAWTAIGGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVVLH
    Newman          NVPLLDIVFTRAWTAIGGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVVLH
    USA300_FPR3757  NVPLLDIVFTRAWTAIGGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVVLH
                    ********************************************************* **

    COL             GIWDTSLTVLGSDTLKIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE
    N315            GIWDTSLTVLGSDTLKIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE
    NCTC8325        GIWDTSLTVLGSDTLKIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE
    Newman          GIWDTSLTVLGSDTLKIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE
    USA300_FPR3757  GIWDTSLTVLGSDTLKIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE
                    *******************************************************