From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001105000
  • symbol?: hmp
  • description?: nitric oxide dioxygenase

      descriptions from strain specific annotations:

    • nitric oxide dioxygenase
    • flavohemoprotein
    • globin domain-containing protein
    • putative flavohemoprotein
    • Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase)
    • dihydropteridine reductase
    • flavohemo(Hemoglobin-like protein) (Flavohemoglobin) (Nitricoxide dioxygenase) (NO oxygenase) (NOD)
    • flavohemoprotein, putative
    • globin
  • strand?: -
  • coordinates?: 1383109..1384254
  • synteny block?: BlockID0006250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0240
    08BA02176:
    C248_0225
    11819-97:
    MS7_0226 (yhb1)
    71193:
    ST398NM01_0251
    ECT-R 2:
    ECTR2_200
    ED133:
    SAOV_0177
    ED98:
    SAAV_0205
    HO 5096 0412:
    SAEMRSA15_01990
    JH1:
    SaurJH1_0230
    JH9:
    SaurJH9_0224
    JKD6008:
    SAA6008_00210
    JKD6159:
    SAA6159_00217
    LGA251:
    SARLGA251_02040
    M013:
    M013TW_0219
    MRSA252:
    SAR0233
    MSHR1132:
    SAMSHR1132_02080
    MSSA476:
    SAS0216
    Mu3:
    SAHV_0239
    Mu50:
    SAV0240
    MW2:
    MW0216
    RF122:
    SAB0179c
    ST398:
    SAPIG0251
    T0131:
    SAT0131_00230
    TCH60:
    HMPREF0772_10264 (hmpA)
    TW20:
    SATW20_02420
    USA300_TCH1516:
    USA300HOU_0249 (hmp)
    VC40:
    SAVC_00940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
    N315            MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
    NCTC8325        MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
    Newman          MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
    USA300_FPR3757  MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSALAQA
                    ************************************************************

    COL             VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQ
    N315            VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGENLLKAIQDVTGLEEHDPVIQ
    NCTC8325        VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQ
    Newman          VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQ
    USA300_FPR3757  VMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQ
                    ***************************************:**************:*****

    COL             AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
    N315            AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
    NCTC8325        AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
    Newman          AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
    USA300_FPR3757  AWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESEDIKSFTVETEEYDFSEFT
                    ************************************************************

    COL             PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
    N315            PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
    NCTC8325        PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
    Newman          PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
    USA300_FPR3757  PGQYITVDVSSDKLPYRAKRHYSIVSGEKNHLTFGVKRDVTTEHEGEVSTILHDEIKEGD
                    ************************************************************

    COL             MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
    N315            MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
    NCTC8325        MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
    Newman          MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
    USA300_FPR3757  MINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASAKGLDTQMVQVAENEQHLPF
                    ************************************************************

    COL             KDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQVFLANKPEIYICGGTKFLQSMIEALKS
    N315            KDNFNSIASHYDNAKLYTHLKDKQGYIGTEELQAFLANKPEIYICGGTKFLQSMIEALKS
    NCTC8325        KDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQVFLANKPEIYICGGTKFLQSMIEALKS
    Newman          KDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQVFLANKPEIYICGGTKFLQSMIEALKS
    USA300_FPR3757  KDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQVFLANKPEIYICGGTKFLQSMIEALKS
                    **********:*****************:****.**************************

    COL             LNYDMDRVHYETFIPRLSVAV
    N315            LNYDMDRVHYETFIPRLSVAV
    NCTC8325        LNYDMDRVHYETFIPRLSVAV
    Newman          LNYDMDRVHYETFIPRLSVAV
    USA300_FPR3757  LNYDMDRVHYETFIPRLSVAV
                    *********************