From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001110000
  • symbol?: glcC
  • description?: PTS glucose transporter subunit IIB

      descriptions from strain specific annotations:

    • PTS glucose transporter subunit IIB
    • PTS system, IIBC components
    • PTS system glucose-specific transporter subunit IIBC
    • PTS family glucose/glucoside (glc) porter component IIABC
    • phosphotransferase system enzyme II
    • pseudogene
    • PTS enzyme
    • PTS system, glucose-like IIB component domain protein
    • PTS system, glucose-like IIB subunint
    • PTS system, maltose and glucose-specific IIC component / PTS system, maltose and glucose-specific IIB component
    • PTS system glucose-like transporter subunit IIB
    • pts system glucose-specific eiicba component (eiicba-glc) (eii-glc/eiii-glc)
    • PTS system maltose/glucose-specific IICB component
    • PTS system maltose-and glucose-specific EIICB component
    • PTS system transporter subunit IIBC
    • PTS transport system, IIBC component
    • putative PTS transport system, IIBC component
  • strand?: -
  • coordinates?: 1386114..1387564
  • synteny block?: BlockID0006300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0242
    08BA02176:
    C248_0228
    11819-97:
    MS7_0229
    71193:
    ST398NM01_0254
    ECT-R 2:
    ECTR2_203
    ED133:
    SAOV_0180
    ED98:
    SAAV_0208
    HO 5096 0412:
    SAEMRSA15_02010
    JH1:
    SaurJH1_0233
    JH9:
    SaurJH9_0227
    JKD6008:
    SAA6008_00214
    JKD6159:
    SAA6159_00219
    LGA251:
    SARLGA251_02060
    M013:
    M013TW_0222
    MRSA252:
    SAR0235
    MSHR1132:
    SAMSHR1132_02100
    MSSA476:
    SAS0218
    Mu3:
    SAHV_0241
    Mu50:
    SAV0242
    MW2:
    MW0218
    RF122:
    SAB0181c
    ST398:
    SAPIG0254
    T0131:
    SAT0131_00233
    TCH60:
    HMPREF0772_10261 (ptsG)
    TW20:
    SATW20_02440
    USA300_TCH1516:
    USA300HOU_0252
    VC40:
    SAVC_00950

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYPILDITLLQNIFTL
    N315            --MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYPILDITLLQNIFTL
    NCTC8325        --MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYPILDITLLQNIFTL
    Newman          MLMKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYPILDITLLQNIFTL
    USA300_FPR3757  --MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYPILDITLLQNIFTL
                      **********************************************************

    COL             MSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNATMNGLLTITGTLAKD
    N315            MSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNATMNGLLTITGTLAKD
    NCTC8325        MSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNATMNGLLTITGTLAKD
    Newman          MSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNATMNGLLTITGTLAKD
    USA300_FPR3757  MSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNATMNGLLTITGTLAKD
                    ************************************************************

    COL             QLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPYLGFFGGSRFVPIVTA
    N315            QLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPYLGFFGGSRFVPIVTA
    NCTC8325        QLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPYLGFFGGSRFVPIVTA
    Newman          QLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPYLGFFGGSRFVPIVTA
    USA300_FPR3757  QLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPYLGFFGGSRFVPIVTA
                    ************************************************************

    COL             FAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILRLLGPLGLHHIFYLPFW
    N315            FAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILRLLGPLGLHHIFYLPFW
    NCTC8325        FAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILRLLGPLGLHHIFYLPFW
    Newman          FAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILRLLGPLGLHHIFYLPFW
    USA300_FPR3757  FAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILRLLGPLGLHHIFYLPFW
                    ************************************************************

    COL             QTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMSGRFITMMFGLCGAALAI
    N315            QTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMSGRFITMMFGLCGAALAI
    NCTC8325        QTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMSGRFITMMFGLCGAALAI
    Newman          QTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMSGRFITMMFGLCGAALAI
    USA300_FPR3757  QTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMSGRFITMMFGLCGAALAI
                    ************************************************************

    COL             YHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVIHAFFDGLAFMMADI
    N315            YHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVIHAFFDGLAFMMADI
    NCTC8325        YHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVIHAFFDGLAFMMADI
    Newman          YHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVIHAFFDGLAFMMADI
    USA300_FPR3757  YHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPILYVIHAFFDGLAFMMADI
                    ************************************************************

    COL             FNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWFCLYYIVFRFLITKFNFKTP
    N315            FNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWFCLYYIVFRFLITKFNFKTP
    NCTC8325        FNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWFCLYYIVFRFLITKFNFKTP
    Newman          FNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWFCLYYIVFRFLITKFNFKTP
    USA300_FPR3757  FNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWFCLYYIVFRFLITKFNFKTP
                    ************************************************************

    COL             GREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRLRVTLHQNDKVDKVLLESTGA
    N315            GREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRLRVTLNQNDKVDKVLLESTGA
    NCTC8325        GREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRLRVTLHQNDKVDKVLLESTGA
    Newman          GREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRLRVTLHQNDKVDKVLLESTGA
    USA300_FPR3757  GREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRLRVTLHQNDKVDKVLLESTGA
                    ********************************************:***************

    COL             KGVIQQGTGVQVIYGPHVTVIKNEIEELLGD
    N315            KGVIQQGTGVQVIYGPHVTVIKNEIEELLGD
    NCTC8325        KGVIQQGTGVQVIYGPHVTVIKNEIEELLGD
    Newman          KGVIQQGTGVQVIYGPHVTVIKNEIEELLGD
    USA300_FPR3757  KGVIQQGTGVQVIYGPHVTVIKNEIEELLGD
                    *******************************