From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001120000
  • symbol?:
  • description?: sorbitol dehydrogenase

      descriptions from strain specific annotations:

    • sorbitol dehydrogenase
    • Galactitol-1-phosphate 5-dehydrogenase
    • alcohol dehydrogenase
    • arabitol-phosphate dehydrogenase
    • L-iditol 2-dehydrogenase
    • putative zinc-binding dehydrogenase
    • sorbitol dehydrogenase (L-iditol 2-dehydrogenase)(Glucitol dehydrogenase)
    • zinc-binding alcohol dehydrogenase
    • zinc-binding dehydrogenase family protein
    • zinc-binding sorbitol dehydrogenase
  • strand?: +
  • coordinates?: 1393728..1394780
  • synteny block?: BlockID0006400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0233 (gutB)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0248
    08BA02176:
    C248_0235
    11819-97:
    MS7_0236
    71193:
    ST398NM01_0260
    ECT-R 2:
    ECTR2_209
    ED133:
    SAOV_0187
    ED98:
    SAAV_0215
    HO 5096 0412:
    SAEMRSA15_02070
    JH1:
    SaurJH1_0239
    JH9:
    SaurJH9_0233
    JKD6008:
    SAA6008_00221
    JKD6159:
    SAA6159_00225
    LGA251:
    SARLGA251_02120
    M013:
    M013TW_0229
    MRSA252:
    SAR0243
    MSHR1132:
    SAMSHR1132_02160
    MSSA476:
    SAS0224
    Mu3:
    SAHV_0247
    Mu50:
    SAV0248
    MW2:
    MW0224
    RF122:
    SAB0187
    ST398:
    SAPIG0260
    T0131:
    SAT0131_00239
    TCH60:
    HMPREF0772_10255 (gutB)
    TW20:
    SATW20_02500
    USA300_TCH1516:
    USA300HOU_0259 (gutB)
    VC40:
    SAVC_00980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
    N315            MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
    NCTC8325        MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
    Newman          MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
    USA300_FPR3757  MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHTYEGHYKVNFPVTLGH
                    ************************************************************

    COL             EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
    N315            EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGVFT
    NCTC8325        EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
    Newman          EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
    USA300_FPR3757  EFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNLCNHRKGIGTQVDGAFT
                    *********************************************************.**

    COL             NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
    N315            NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
    NCTC8325        NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
    Newman          NYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
    USA300_FPR3757  NYVIAREESLHHIPDEVSYQSAAMTEPLACAYHGVSKIQVNSGDVAVVMGPGPIGLLVAQ
                    *******************************:****************************

    COL             VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
    N315            VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
    NCTC8325        VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
    Newman          VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
    USA300_FPR3757  VLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKTYINGITDGYGADVVVECS
                    ************************************************************

    COL             GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
    N315            GAVPAARQGLDIIRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
    NCTC8325        GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
    Newman          GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
    USA300_FPR3757  GAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKEITVVGSRSQKPADWEPSLQ
                    ************:***********************************************

    COL             LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKVLLKPLDLDENEGEN
    N315            LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
    NCTC8325        LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLKPLDLDENEGEN
    Newman          LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKVLLKPLDLDENEGEN
    USA300_FPR3757  LMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKVLLKTLDLDENEGEN
                    ************************************.***.**********