From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001145000
  • symbol?:
  • description?: PTS system, IIA component

      descriptions from strain specific annotations:

    • PTS system, IIA component
    • PTS family glucose/glucoside (glc) porter component IIABC
    • PTS system, glucose subfamily, IIA component domain protein
    • PTS system, N-acetylglucosamine-specific IIA component / PTS system, N-acetylglucosamine-specific IIB component / PTS system, N-acetylglucosamine-specific IIC component
    • PTS system beta-glucoside-specific transporter subunit IIABC
    • PTS system glucose-specific IIA component
    • PTS system glucose subfamily transporter subunit IIA
    • PTS system transporter subunit IIA
    • PTS system transport protein
    • PTS transporter
    • PTS transport system protein
    • putative PTS transport system protein
  • strand?: +
  • coordinates?: 1420554..1421398
  • synteny block?: BlockID0006650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0265
    08BA02176:
    C248_0254
    11819-97:
    MS7_0255 (ptbA)
    71193:
    ST398NM01_0279
    ECT-R 2:
    ECTR2_226 (ptbA)
    ED133:
    SAOV_0206
    ED98:
    SAAV_0233
    HO 5096 0412:
    SAEMRSA15_02250
    JH1:
    SaurJH1_0256
    JH9:
    SaurJH9_0250
    JKD6008:
    SAA6008_00240
    JKD6159:
    SAA6159_00243
    LGA251:
    SARLGA251_02300
    M013:
    M013TW_0246
    MRSA252:
    SAR0263
    MSHR1132:
    SAMSHR1132_02320
    MSSA476:
    SAS0242
    Mu3:
    SAHV_0264
    Mu50:
    SAV0265
    MW2:
    MW0241
    RF122:
    SAB0204
    ST398:
    SAPIG0279
    T0131:
    SAT0131_00259
    TCH60:
    HMPREF0772_10236
    TW20:
    SATW20_02680
    USA300_TCH1516:
    USA300HOU_0276
    VC40:
    SAVC_01065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTANEVKQIVDVTSVAEND
    N315            MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTANEVKQIVDVTSVAEND
    NCTC8325        MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTANEVKQIVDVTSVAEND
    Newman          MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTANEVKQIVDVTSVAEND
    USA300_FPR3757  MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTANEVKQIVDVTSVAEND
                    ************************************************************

    COL             TQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYTPQVKVTTPILVKAPIA
    N315            AQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYTPQVKVTTPILVKAPIA
    NCTC8325        TQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYTPQVKVTTPILVKAPIA
    Newman          TQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYTPQVKVTTPILVKAPIA
    USA300_FPR3757  TQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYTPQVKVTTPILVKAPIA
                    :***********************************************************

    COL             GRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISMIVPTKHAVGIQSEDGVD
    N315            GRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISMIVPTKHAVGIQSEDGVD
    NCTC8325        GRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISMIVPTKHAVGIQSEDGVD
    Newman          GRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISMIVPTKHAVGIQSEDGVD
    USA300_FPR3757  GRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISMIVPTKHAVGIQSEDGVD
                    ************************************************************

    COL             IVIHIGVNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQQQGYNADVIVVISNSADL
    N315            IVIHIGVNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQQQGYNADVIVVISNSADL
    NCTC8325        IVIHIGVNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQQQGYNADVIVVISNSADL
    Newman          IVIHIGVNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQQQGYNADVIVVISNSADL
    USA300_FPR3757  IVIHIGLNTVDLEGKGFKCFVKQNDHVEAGQTLLQFDQQYIQQQGYNADVIVVISNSADL
                    ******:*****************************************************

    COL             GKVELTMNEIITTEDVIFKIFKN
    N315            GKVELTMNEIITTEDVIFKIFKN
    NCTC8325        GKVELTMNEIITTEDVIFKIFKN
    Newman          GKVELTMNEIITTEDVIFKIFKN
    USA300_FPR3757  GKVELTMNEIITTEDVIFKIFKN
                    ***********************