From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001152000
  • symbol?:
  • description?: SAM-dependent methyltransferase

      descriptions from strain specific annotations:

    • SAM-dependent methyltransferase
    • Methyltransferase
    • methyltransferase domain family
    • methyltransferase domain protein
  • strand?: -
  • coordinates?: 1423808..1424988
  • synteny block?: BlockID0006720
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0267 (ubiE)
    08BA02176:
    C248_0257
    11819-97:
    MS7_0257
    71193:
    ST398NM01_0282
    ECT-R 2:
    ECTR2_228
    ED133:
    SAOV_0208
    ED98:
    SAAV_0235
    HO 5096 0412:
    SAEMRSA15_02270
    JH1:
    SaurJH1_0258
    JH9:
    SaurJH9_0252
    JKD6008:
    SAA6008_00242
    JKD6159:
    SAA6159_00246
    LGA251:
    SARLGA251_02320
    M013:
    M013TW_0248
    MRSA252:
    SAR0265
    MSHR1132:
    MSSA476:
    SAS0244
    Mu3:
    SAHV_0266
    Mu50:
    SAV0267
    MW2:
    MW0243
    RF122:
    SAB0207c
    ST398:
    SAPIG0282
    T0131:
    SAT0131_00261
    TCH60:
    HMPREF0772_10233
    TW20:
    SATW20_02700
    USA300_TCH1516:
    USA300HOU_0279
    VC40:
    SAVC_01080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVACNMCTTSIYLAHTYG
    N315            MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVACNMCTTSIYLAHTYG
    NCTC8325        MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVACNMCTTSIYLAHTYG
    Newman          MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVACNMCTTSIYLAHTYG
    USA300_FPR3757  MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVACNMCTTSIYLAHTYG
                    ************************************************************

    COL             CHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVLNEAMLTMLPI
    N315            CHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVLNEAMLTMLPI
    NCTC8325        CHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVLNEAMLTMLPI
    Newman          CHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVLNEAMLTMLPI
    USA300_FPR3757  CHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDNQFDIVLNEAMLTMLPI
                    ************************************************************

    COL             AIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAAINVNVSPQTKLGWLDLY
    N315            AIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAAINVNVSPQTKLGWLDLY
    NCTC8325        AIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAAINVNVSPQTKLGWLDLY
    Newman          AIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAAINVNVSPQTKLGWLDLY
    USA300_FPR3757  AIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAAINVNVSPQTKLGWLDLY
                    ************************************************************

    COL             NQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIINNALKKENRPMFCKMFKTMTKLRK
    N315            HQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIIKNALKKENRPMFCKMFKTMTKLRK
    NCTC8325        NQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIINNALKKENRPMFCKMFKTMTKLRK
    Newman          NQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIINNALKKENRPMFCKMFKTMTKLRK
    USA300_FPR3757  NQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIINNALKKENRPMFCKMFKTMTKLRK
                    :***********************************:***********************

    COL             DMNYITFVAKKEH
    N315            DMNYITFVAKKED
    NCTC8325        DMNYITFVAKKEH
    Newman          DMNYITFVAKKEH
    USA300_FPR3757  DMNYITFVAKKEH
                    ************.