From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001156000
  • symbol?: rbsU
  • description?: ribose transporter

      descriptions from strain specific annotations:

    • ribose transporter
    • sugar transport family protein
    • Putative ribose uptake protein RbsU, GRP transporter family
    • sugar transport protein
    • ribose transporter RbsU
    • DMT superfamily drug/metabolite transporter
    • putative sugar transport protein
    • Putative ribose uptake protein rbsU
    • membrane protein
  • strand?: -
  • coordinates?: 1427475..1428356
  • synteny block?: BlockID0006760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0204 (rbsU)
    USA300_FPR3757:
    04-02981:
    SA2981_0270 (rbsU)
    08BA02176:
    C248_0260 (rbsU)
    11819-97:
    MS7_0260
    71193:
    ST398NM01_0285
    ECT-R 2:
    ECTR2_231
    ED133:
    SAOV_0211
    ED98:
    SAAV_0238
    HO 5096 0412:
    SAEMRSA15_02300
    JH1:
    SaurJH1_0261
    JH9:
    SaurJH9_0255
    JKD6008:
    SAA6008_00245 (rbsU)
    JKD6159:
    SAA6159_00249 (rbsU)
    LGA251:
    SARLGA251_02350
    M013:
    M013TW_0251
    MRSA252:
    SAR0268
    MSHR1132:
    SAMSHR1132_02370
    MSSA476:
    SAS0247
    Mu3:
    SAHV_0269
    Mu50:
    SAV0270
    MW2:
    MW0246
    RF122:
    SAB0210c
    ST398:
    SAPIG0285
    T0131:
    SAT0131_00265 (plc)
    TCH60:
    HMPREF0772_10230 (rbsU)
    TW20:
    SATW20_02730
    USA300_TCH1516:
    USA300HOU_0282
    VC40:
    SAVC_01095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAIILAVVTSSGFP
    N315            ---MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAIILAVVTSSGFP
    NCTC8325        ---MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAILLAVVTSSGFP
    Newman          MYNMSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAIILAVVTSSGFP
    USA300_FPR3757  ---MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFAIILAVVTSSGLP
                       **********************************************:********:*

    COL             TGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGI
    N315            TGTNLLFALLSGAGWGFGQIITFKAFELIGSSRAMPVTTAFQLLGASLWGVFALGNWPGI
    NCTC8325        TGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGI
    Newman          TGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGI
    USA300_FPR3757  TGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGI
                    ****************************:*******************************

    COL             GHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSI
    N315            GHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSI
    NCTC8325        GHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSI
    Newman          GHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSI
    USA300_FPR3757  GHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSI
                    ************************************************************

    COL             DGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPN
    N315            DGLTAFLPQAMGMVIVAVIYGFMNMKSENPFRNKITWLQIISGFFFAFGALTYLISAQPN
    NCTC8325        DGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPN
    Newman          DGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPN
    USA300_FPR3757  DGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPN
                    **************************:*********************************

    COL             MNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK
    N315            MNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK
    NCTC8325        MNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK
    Newman          MNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK
    USA300_FPR3757  MNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVLILVAASVTVFIK
                    ********************************************************