From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001166000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC-2 transporter family protein
    • ABC-2 type transport system permease
  • strand?: -
  • coordinates?: 1436882..1437991
  • synteny block?: BlockID0006860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0279
    08BA02176:
    C248_0269
    11819-97:
    MS7_0270
    71193:
    ST398NM01_0294
    ECT-R 2:
    ECTR2_240
    ED133:
    SAOV_0220
    ED98:
    SAAV_0247
    HO 5096 0412:
    SAEMRSA15_02380
    JH1:
    SaurJH1_0270
    JH9:
    SaurJH9_0263
    JKD6008:
    SAA6008_00253
    JKD6159:
    SAA6159_00257
    LGA251:
    SARLGA251_02430
    M013:
    M013TW_0260
    MRSA252:
    SAR0276
    MSHR1132:
    SAMSHR1132_02450
    MSSA476:
    SAS0255
    Mu3:
    SAHV_0277
    Mu50:
    SAV0279
    MW2:
    MW0255
    RF122:
    SAB0218c
    ST398:
    SAPIG0294
    T0131:
    SAT0131_00274
    TCH60:
    HMPREF0772_10221
    TW20:
    SATW20_02810
    USA300_TCH1516:
    USA300HOU_0292
    VC40:
    SAVC_01140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDDNHFNIGVVDKDQSSE
    N315            MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDDNHFNIGVVDKDQSSE
    NCTC8325        MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDDNHFNIGVVDKDQSSE
    Newman          MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDDNHFNIGVVDKDQSSE
    USA300_FPR3757  MKTIHLFRIYHSFLLKKWYLIIYLLFILAALLITLTTIQHVTEDDNHFNIGVVDKDQSSE
                    ************************************************************

    COL             TKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFDKGMTKAFYKQGELPIS
    N315            TKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFDKGMTKAFYKQGELPIS
    NCTC8325        TKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFDKGMTKAFYKQGELPIS
    Newman          TKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFDKGMTKAFYKQGELPIS
    USA300_FPR3757  TKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFDKGMTKAFYKQGELPIS
                    ************************************************************

    COL             VYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKASHSDSINVMTDLLITGLN
    N315            VYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKASHSDSINVMTDLLITGLN
    NCTC8325        VYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKASHSDSINVMTDLLITGLN
    Newman          VYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKASHSDSINVMTDLLITGLN
    USA300_FPR3757  VYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKASHSDSINVMTDLLITGLN
                    ************************************************************

    COL             RSGAFNLEPIHLYDTGSYYAITGFLTTVFIFALSLFTVLKMNQDTVLKARLKMFHFSKER
    N315            RSGAFNLEPIHLYDTGSYYAITGFLATVFIFALSLFTVLKMNQDTVLKARLKMFHFSKER
    NCTC8325        RSGAFNLEPIHLYDTGSYYAITGFLTTVFIFALSLFTVLKMNQDTVLKARLKMFHFSKER
    Newman          RSGAFNLEPIHLYDTGSYYAITGFLTTVFIFALSLFTVLKMNQDTVLKARLKMFHFSKER
    USA300_FPR3757  RSGAFNLEPIHLYDTGSYYAITGFLTTVFIFALSLFTVLKMNQDTVLKARLKMFHFSKER
                    *************************:**********************************

    COL             LLIIRTLITWFYTMLWSIVGVVWIVFSIPNIFELYNWPTLAIHLSYYVTFLILWLLLIEL
    N315            LLIIRALITWFYTMLWSIVGVVWIVFSIPNTFELYNWPTLAIHLSYYVTFLILWLLLIEL
    NCTC8325        LLIIRTLITWFYTMLWSIVGVVWIVFSIPNIFELYNWPTLAIHLSYYVTFLILWLLLIEL
    Newman          LLIIRTLITWFYTMLWSIVGVVWIVFSIPNIFELYNWPTLAIHLSYYVTFLILWLLLIEL
    USA300_FPR3757  LLIIRTLITWFYTMLWSIVGVVWIVFSIPNIFELYNWPTLAIHLSYYVTFLILWLLLIEL
                    *****:************************ *****************************

    COL             LTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFNIQPFAVVTNQLLEIILNNYI
    N315            LTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFNIQPFAVVTNQLLEIILNNYI
    NCTC8325        LTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFNIQPFAVVTNQLLEIILNNYI
    Newman          LTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFNIQPFAVVTNQLLEIILNNYI
    USA300_FPR3757  LTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFNIQPFAVVTNQLLEIILNNYI
                    ************************************************************

    COL             LELHPSFYLSFIALLIINLAVLVWRYRQ
    N315            LELHPSFYLSFIALLIINLAVLVWRYRQ
    NCTC8325        LELHPSFYLSFIALLIINLAVLVWRYRQ
    Newman          LELHPSFYLSFIALLIINLAVLVWRYRQ
    USA300_FPR3757  LELHPSFYLSFIALLIINLAVLVWRYRQ
                    ****************************