From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001168000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 1438116..1439641
  • synteny block?: BlockID0006880
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0280
    08BA02176:
    C248_0270
    11819-97:
    MS7_0271
    71193:
    ST398NM01_0295
    ECT-R 2:
    ECTR2_241
    ED133:
    SAOV_0221
    ED98:
    SAAV_0248
    HO 5096 0412:
    SAEMRSA15_02390
    JH1:
    SaurJH1_0271
    JH9:
    SaurJH9_0264
    JKD6008:
    SAA6008_00254
    JKD6159:
    SAA6159_00258
    LGA251:
    SARLGA251_02440
    M013:
    M013TW_0261
    MRSA252:
    SAR0277
    MSHR1132:
    SAMSHR1132_02460
    MSSA476:
    SAS0256
    Mu3:
    SAHV_0278
    Mu50:
    SAV0280
    MW2:
    MW0256
    RF122:
    SAB0219c
    ST398:
    SAPIG0295
    T0131:
    TCH60:
    HMPREF0772_10220
    TW20:
    SATW20_02820
    USA300_TCH1516:
    USA300HOU_0293
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTAKMYKDYFNDR
    N315            -----MSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTAKMYKDYFNDR
    NCTC8325        -----MSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTAKMYKDYFNDR
    Newman          MGGSKMSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTAKMYKDYFNDR
    USA300_FPR3757  -----MSKKLKIIIPIIIVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTAKMYKDYFNDR
                         *******************************************************

    COL             FENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMSYGHDPKKEKSM
    N315            FENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMSYGHDPKKEKSM
    NCTC8325        FENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMSYGHDPKKEKSM
    Newman          FENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMSYGHDPKKEKSM
    USA300_FPR3757  FENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMSYGHDPKKEKSM
                    ************************************************************

    COL             INLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSKLTGEDEETAKEN
    N315            INLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSKLTGEDEETAKEN
    NCTC8325        INLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSKLTGEDEETAKEN
    Newman          INLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSKLTGEDEETAKEN
    USA300_FPR3757  INLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSKLTGEDEETAKEN
                    ************************************************************

    COL             GITNQQLNLNTLFNNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGKKEEIKVNGEKYKV
    N315            GITNQQLNLNTLFSNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGKKEEIKVNGEKYKV
    NCTC8325        GITNQQLNLNTLFNNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGKKEEIKVNGEKYKV
    Newman          GITNQQLNLNTLFNNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGKKEEIKVNGEKYKV
    USA300_FPR3757  GITNQQLNLNTLFNNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGKKEEIKVNGEKYKV
                    *************.**********************************************

    COL             RPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGARKDFEKDIKKAIDDVKETKKDE
    N315            RPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDYDKDIKKAIDDVKETKKDE
    NCTC8325        RPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDFEKDIKKAIDDVKETKKDE
    Newman          RPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDFEKDIKKAIDDVKETKKDE
    USA300_FPR3757  RPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDFEKDIKKAIDDVKETKKDE
                    ************************************** **::*****************

    COL             FAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKLDYALDFDQDKYTYAE
    N315            FAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKLDYALDFDQDKYTYAE
    NCTC8325        FAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKLDYALDFDQDKYTYAE
    Newman          FAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLK----------------
    USA300_FPR3757  FAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKLDYALDFDQDKYTYAE
                    ********************************************                

    COL             AKYTIKGVSSKEKDNKYNDKYEFGKKTEYDESKIKLDNQEKVDGTKRQDKGKITVALDKY
    N315            AKYTIKGVSSKEKDNKYSDKYEFGKKTEYDESKIKLDNQEKVDGTKRQDKGKITVALDKY
    NCTC8325        AKYTIKGVSSKEKDNKYNDKYEFGKKTEYDESKIKLDNQEKVDGTKRQDKGKITVALDKY
    Newman          ------------------------------------------------------------
    USA300_FPR3757  AKYTIKGVSSKEKDNKYNDKYEFGKKTEYDESKIKLDNQEKVDGTKRQDKGKITVALDKY
                                                                                

    COL             SDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSSTKLKADIDFDDSGAKDF
    N315            SDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSSTKLKADIDFDDSGAKDF
    NCTC8325        SDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSSTKLKADIDFDDSGAKDF
    Newman          -------------------------------------------TRLRT------------
    USA300_FPR3757  SDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSSTKLKADIDFDDSGAKDF
                                                               *:*::            

    COL             NSLSSKDREKLEKEIEKNGGKMFESILKKASK
    N315            NSLSSKDREKLEKEIEKNGGKMFESILKKASK
    NCTC8325        NSLSSKDREKLEKEIEKNGGKMFESILKKASK
    Newman          --------------------------------
    USA300_FPR3757  NSLSSKDREKLEKEIEKNGGKMFESILKKASK