From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001223000
  • symbol?:
  • description?: formate/nitrite transporter

      descriptions from strain specific annotations:

    • formate/nitrite transporter
    • formate/nitrite transporter family protein
    • FNT family formate-nitrite transporter
    • formate/nitrate transporter
    • formate-nitrite transporter
    • putative formate/nitrite transporter
  • strand?: -
  • coordinates?: 1510673..1511369
  • synteny block?: BlockID0007340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0304
    08BA02176:
    C248_0293
    11819-97:
    MS7_0295
    71193:
    ST398NM01_0318
    ECT-R 2:
    ECTR2_265
    ED133:
    SAOV_0257
    ED98:
    SAAV_0272
    HO 5096 0412:
    SAEMRSA15_02610
    JH1:
    SaurJH1_0295
    JH9:
    SaurJH9_0288
    JKD6008:
    SAA6008_00281
    JKD6159:
    SAA6159_00280
    LGA251:
    SARLGA251_02670
    M013:
    M013TW_0286
    MRSA252:
    SAR0302
    MSHR1132:
    SAMSHR1132_02790
    MSSA476:
    SAS0282
    Mu3:
    SAHV_0302
    Mu50:
    SAV0305
    MW2:
    MW0282
    RF122:
    SAB0242c
    ST398:
    SAPIG0318
    T0131:
    SAT0131_00305 (lldP)
    TCH60:
    HMPREF0772_10191
    TW20:
    SATW20_03100
    USA300_TCH1516:
    USA300HOU_0324
    VC40:
    SAVC_01275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSEDVIVKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMMAGFIIGII
    N315            -------MKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMMAGFIIGII
    NCTC8325        -------MKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMMAGFIIGII
    Newman          MKSEDVIVKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMMAGFIIGII
    USA300_FPR3757  --------------------------------------------------MMAGFIIGII
                                                                      **********

    COL             TVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIK
    N315            TVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIK
    NCTC8325        TVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIK
    Newman          TVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIK
    USA300_FPR3757  TVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFTVGLYYKVIK
                    ************************************************************

    COL             PTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKA
    N315            PTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKA
    NCTC8325        PTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKA
    Newman          PTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKA
    USA300_FPR3757  PTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLSTGFVSILMKA
                    ************************************************************

    COL             IFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTL
    N315            IFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTL
    NCTC8325        IFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTL
    Newman          IFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTL
    USA300_FPR3757  IFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLFMGGLIYQVDTL
                    ************************************************************

    COL             HFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN
    N315            HFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN
    NCTC8325        HFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN
    Newman          HFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN
    USA300_FPR3757  HFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN
                    *****************************************